KEGG   Helicoverpa armigera (cotton bollworm): 110382730Help
Entry
110382730         CDS       T05609                                 

Definition
(RefSeq) cathepsin O-like
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw04142  Lysosome
Brite
KEGG Orthology (KO) [BR:haw00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110382730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:haw01002]
    110382730
Enzymes [BR:haw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     110382730
Peptidases [BR:haw01002]
 Cysteine Peptidases
  Family C1: papain family
   110382730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 4HB_MCP_1
Motif
Other DBs
NCBI-GeneID: 110382730
NCBI-ProteinID: XP_021199083
Position
Unknown
AA seq 355 aa AA seqDB search
MVNTNYVLFISSLICMVIQVSLFLKCILAFDKSILNENVKTLDVAKLRFEAYLKDFNKTY
YGFERDGRFENFKNSLKNIARSNALEGRTVFGLTKFSDMSPREFRDTVLDNYMDFSMCTK
LSLDCVDNYETSGQETVYNKEPPSSFDWRPKGVVKPVLNQKKCLGCWAFGIVGVVESMSA
IRGLDHKSRSIQEVLDCSEYTNGCRGGSVSRALRYLCQEKIPIVTEQEYPLTLGLEKDCK
LAPHSTGRLIRHFDYQCKVSETAMMGQIAFHGPLIATVDATNWINYIGGVIQRACTRGIA
NHVVQIVGYVQNVEIPYFIVRNSLGEDFGENGYVKVAMFDNICGIADRVTKLDVM
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggttaacacaaactacgtactttttatatcatctttaatatgtatggtaattcaagtt
tctctgtttctaaagtgtattcttgcgtttgataagtcaatattaaatgaaaatgtaaaa
actttggacgtggccaagttaaggtttgaagcttatttgaaagatttcaacaagacctat
tatggtttcgaacgtgatggaagattcgagaattttaagaactcattaaaaaacatagcc
agatcaaatgcattagagggcagaacagtgtttggattgacaaagttctcagatatgtcg
ccccgagaattcagggatactgtcctggataattatatggatttctctatgtgcactaaa
ttgtcacttgactgtgttgataattatgaaacttcaggtcaggaaactgtttataataaa
gaacctcccagctcatttgattggcgaccaaaaggggtggtaaaacccgttttgaaccaa
aagaagtgtctaggatgttgggcctttggcatcgtcggagttgtggagtccatgtcagcg
atacgaggtcttgatcacaagagtcggagcatccaggaagtactggactgctccgaatac
accaacggttgtcgaggaggcagcgtcagtagagcactcagatatctctgtcaggaaaaa
ataccaattgtgacggagcaggaataccccctgactttgggtttggagaaagactgcaag
ttggccccgcattctactggcagacttattcgtcattttgattatcaatgcaaagtcagc
gaaactgccatgatgggtcagatagcgttccacggaccgctaatcgccacggtagacgct
acgaactggatcaattacatcggtggagtcattcaaagagcttgcacgcgcggcatagca
aatcacgtagtacaaatagtaggttacgtgcaaaatgtagagataccatactttatcgtc
aggaactctttaggggaagactttggtgaaaatggatatgtgaaggtcgccatgtttgac
aatatctgtgggattgctgaccgggtcaccaagcttgatgtcatgtag

DBGET integrated database retrieval system