KEGG   Helicoverpa armigera (cotton bollworm): 110383156Help
Entry
110383156         CDS       T05609                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
haw  Helicoverpa armigera (cotton bollworm)
Pathway
haw00450  Selenocompound metabolism
haw00970  Aminoacyl-tRNA biosynthesis
haw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:haw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    110383156
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110383156
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:haw01007]
    110383156
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:haw03016]
    110383156
Enzymes [BR:haw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     110383156
Amino acid related enzymes [BR:haw01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   110383156
Transfer RNA biogenesis [BR:haw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110383156
 Prokaryotic type
   Other AARSs
    110383156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WHEP-TRS tRNA-synt_1g K-box
Motif
Other DBs
NCBI-GeneID: 110383156
NCBI-ProteinID: XP_021199575
Position
Unknown
AA seq 438 aa AA seqDB search
KSNVIVFFSSEYLNYEDGKFSKSRGVGVFGTDAQDTGIPSDVWRFYLASIRPETSDSSFS
WTELGTRNNSELLNNLGNFCHRSLSFCANSYKGKVPDLELTQADYELIALVNREVIAYVQ
HMEKGRLREALRHVLSVSRLGNQHMQSQQPWVLLKGSDDDKKRGGTAIGLCCQLVALLCA
LLSPYLPETVRKLREQLNLKQEALRINPENPSLLQYLPSGHVIGKPEPLFAKIEAEVLDK
LRAKYAGTQSERASKENGTAPGSVAELEEAVKQQGEKVRQLKASTKDKTVWQPEVAKLLE
LKKQLEAAQKQAAQTQAAQKQSAQTQGDVSSLEKAVAEQADKVRQLKASTKDKTVWQPEV
NKLLDLKKQLSAAQSAPAVTQSASANSADLSALEKELAEQADKVRKLKASTKDKSVWQPE
VNKLLAIKKQLADLQINK
NT seq 1319 nt NT seq  +upstreamnt  +downstreamnt
gaaaatctaatgtaattgtttttttttcctcagaatacttgaactacgaagacggaaagt
tctcgaagtctcgaggcgttggcgttttcggcacagacgctcaggacactggaataccgt
cagacgtgtggcggttctacctcgctagcatcagaccagagacttctgactccagcttca
gttggactgaacttggtactaggaataattcagagctcctgaacaatttgggcaacttct
gtcatcgctcgctcagtttctgcgcgaactcgtacaaggggaaagtgcccgaccttgagt
tgactcaggctgactacgaattgattgcgctagttaatagggaagttattgcctacgtcc
agcacatggaaaaaggtcgtctccgagaggcgttacgtcacgtcctctcagtctcccggc
tcggcaaccagcacatgcagtcgcagcaaccatgggtgctgctcaagggctctgatgacg
acaagaaacgcggcggcacagcgatcggtctatgctgtcaactggtggcgttgctatgtg
ctctgctgtcgccctacctgcccgagactgtcaggaaactgagggaacaactcaacttaa
aacaagaggcattaaggattaacccagaaaacccctcgctactgcaatacttgccatcgg
gacatgtaatcggcaagcccgagcctttgttcgcgaagatagaggccgaagtactcgaca
agttacgagcgaagtacgctggtacacagagcgagagggcgagcaaggaaaacggcacag
caccaggatctgtagcagaattagaagaagctgtcaaacaacagggtgaaaaagtacgtc
aactcaaagcgtcgacaaaagacaagactgtgtggcagcccgaagtggccaagctgttag
aactcaagaaacagctcgaagctgcacagaaacaagctgcacaaacacaggctgcacaga
aacagagtgcacaaacacagggagatgtcagtagcttggagaaagctgtcgctgaacagg
ccgataaagtacgtcaactcaaagcgtcgacaaaagacaagacggtttggcagccggagg
tcaataaactcttggaccttaagaagcagttgtcggccgcgcaatccgcacctgctgtca
cgcagtcggcatcggctaatagtgctgatttatcggcgctagagaaagaacttgctgaac
aggccgacaaagtccggaaactgaaagcttcaacaaaggacaagagcgtatggcaacccg
aagtgaacaaacttctggctatcaagaaacaactcgccgacttgcaaataaacaaataa

DBGET integrated database retrieval system