KEGG   Halobacteriovorax sp. BALOs_7: BALOs_0551Help
Entry
BALOs_0551        CDS       T05649                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hax  Halobacteriovorax sp. BALOs_7
Pathway
hax00450  Selenocompound metabolism
hax00970  Aminoacyl-tRNA biosynthesis
hax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hax00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BALOs_0551
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BALOs_0551
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hax01007]
    BALOs_0551
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hax03016]
    BALOs_0551
Enzymes [BR:hax01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BALOs_0551
Amino acid related enzymes [BR:hax01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BALOs_0551
Transfer RNA biogenesis [BR:hax03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BALOs_0551
 Prokaryotic type
   Other AARSs
    BALOs_0551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 tRNA-synt_1c tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: AYF43563
Position
complement(566802..568286)
Genome map
AA seq 494 aa AA seqDB search
MKNTFYATTAIDYPNGRPHIGHAYEKIVTDSYARWNRLLGKDVYFLTGTDENGQKLIESA
KDAGLDTLEFVNKNVEVFKDLCTRANISHDDFIRTTEKRHEDSCVELWKKLEEKGLIYHG
HYSGNYCLSCESFYTEAQAPDGNCPEHHKPLELKEEEGFFFKLSEYQKWIIDHLKANPDF
IVPGARYKEILSRLENDDLRDLAISRPSQGWGVKVPGNDNFVMYTWFDALINYYSALDSD
QKEKFWPADMHVIGKDILWFHSVIWPCMLKAADLPLPKQVYVHGMVLAEDGKKMSKSLGN
VVDPFEMLEKYPTDTFRYYMLKNISSSGDGKFSEQELVDKHNTELANDYGNLLMRVIKLG
LKSFPDKVYTPEGVAQEIDALPYFERAKEFMDKREHNKAIDAIWDLIVSLNQYVNDKEPW
KHKKDEAAFAPIAYNCFYGMAAASYMLQAFLPECTKTALEYIGSSALGTELMEFGAATYT
PQPPEALFPKVELK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacattctatgcaacaacagctatcgactacccaaatgggcgtcctcatatc
ggacatgcttatgagaagattgtaactgactcatacgcacgttggaatagactccttgga
aaagatgtttacttcctaactggaacagatgaaaacggacaaaagcttattgagtcggcc
aaggatgcaggtcttgatacacttgaattcgttaataagaatgtcgaagtttttaaagac
ctttgtacaagagcaaatattagtcatgacgacttcatcagaacaactgagaagcgtcat
gaagattcatgtgttgaactttggaagaaacttgaagagaagggattaatttaccacggg
cactactctggtaattactgtctttcttgtgagtctttctacactgaagcacaagcacct
gatgggaactgccctgagcaccacaagccacttgaactcaaagaagaagaaggcttcttc
tttaaactgagtgaataccaaaaatggattatcgatcacctaaaagcgaaccctgatttt
attgttccaggtgcacgctataaagaaattctttctcgccttgaaaatgacgatctaaga
gaccttgctatttctcgtccaagccaaggatggggtgtaaaggttccaggtaatgataac
tttgttatgtatacttggtttgatgctcttatcaattactactctgctcttgattcagat
caaaaagaaaagttctggccagcagatatgcacgttattggtaaagatatcctttggttc
cattcagtaatttggccatgtatgctaaaggccgcagaccttcctcttccaaaacaagta
tatgttcacggaatggtacttgctgaagatggaaagaaaatgagtaagtctcttggtaat
gttgttgatccatttgagatgcttgaaaaatatccaacggatactttccgctactatatg
ctaaaaaatatttcatcatctggtgatggaaaattctctgaacaagaattagttgataag
cacaatactgagcttgcaaatgactatggaaatcttttaatgagagttatcaaactaggt
ctaaagagctttcctgataaagtctacacgccagaaggtgtggcccaagaaatcgatgct
cttccatattttgagcgtgctaaggagttcatggataagcgtgagcacaacaaggccatt
gatgcgatttgggaccttatcgttagccttaatcaatacgtaaatgataaagagccttgg
aagcataagaaagatgaagcggcatttgctccaatcgcttataactgtttctacggtatg
gcagcagcatcatatatgcttcaggccttccttccagagtgtacgaaaacagctcttgaa
tatattggttcaagtgctcttggaactgaacttatggaatttggggccgcaacttatacg
cctcagccaccggaagctttatttccaaaagtagaacttaaataa

DBGET integrated database retrieval system