KEGG   Halobacteriovorax sp. BALOs_7: BALOs_0867Help
Entry
BALOs_0867        CDS       T05649                                 

Definition
(GenBank) hypothetical protein
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
hax  Halobacteriovorax sp. BALOs_7
Brite
KEGG Orthology (KO) [BR:hax00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hax03009]
    BALOs_0867
Enzymes [BR:hax01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     BALOs_0867
Ribosome biogenesis [BR:hax03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BALOs_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsJ Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AYF43877
Position
complement(867132..868142)
Genome map
AA seq 336 aa AA seqDB search
MHLLMPKDNTWKKFLKDEVMDEFSIKKSQITSPDGLPILEIDEKTPLRKSYLGLALDTLP
ETQTIPAGSIGEQSSLIVNLLKKSNISQTAYQVFSISNKYGVVTNGRSELLSQKLAKNLR
KEGIKRGKFHFKDCPLIKACIYPDRSIKISVLDKVKRQEYDHLLSPFPGGYTTITDDKQA
PSRAFKKLVEAQLVLGKEIKEDETLVDLGACPGGWSYVALNQGAQVTSIDRSPLREDLMP
KVNFSAEDAFKFMTEDGFDWVVSDIICTPDRILELIETWATPQKCKNFVFTIKFKGSDSY
DILQSFKKKLHSLDYDCILRQLNVNKNEVMVMGTRI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcacctactaatgccaaaagataatacctggaaaaagttcctcaaagatgaggtcatg
gatgaattttccatcaagaagtctcaaatcacaagtcctgatgggctaccgattttagaa
attgatgaaaaaacaccattaagaaagagctatcttggtcttgctctggacactttacca
gaaacccaaactattccagctggaagtattggagaacagagctctttgatagttaatctt
ttaaagaagagtaatatttcacaaacagcctatcaagtctttagtatttctaataagtat
ggagtcgtaaccaatggccgcagtgaattattatctcaaaagcttgctaagaatttgaga
aaagaaggaataaagagaggaaagtttcatttcaaagactgcccacttattaaggcctgt
atttatcctgatcgaagcatcaagatttcagttctcgataaagtaaaaaggcaagaatat
gatcatcttcttagtccattccctggtggctacacaacgattaccgatgataagcaggca
ccatcaagagcatttaaaaaacttgtggaagcgcaactcgtacttggaaaagagataaaa
gaagatgaaacattagtagatcttggagcatgtccaggaggatggagttacgttgccctc
aatcaaggagcacaggtcacatcaattgatcgctctcccctaagagaagaccttatgcca
aaagtgaacttcagcgcagaagatgctttcaagtttatgactgaggatggttttgattgg
gtggtttcagatataatttgtactccagatagaattcttgaattaatagaaacttgggcc
acacctcaaaaatgcaaaaactttgtctttaccattaagtttaaaggaagtgacagctac
gatattctccaaagctttaaaaagaaattacatagccttgattacgactgtattttgaga
cagctaaatgtaaataagaatgaagttatggttatgggaactcgaatctag

DBGET integrated database retrieval system