KEGG   Haemophilus sp. oral taxon 036: C3V42_08405Help
Entry
C3V42_08405       CDS       T05707                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hay  Haemophilus sp. oral taxon 036
Pathway
hay00450  Selenocompound metabolism
hay00970  Aminoacyl-tRNA biosynthesis
hay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hay00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C3V42_08405 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C3V42_08405 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hay01007]
    C3V42_08405 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hay03016]
    C3V42_08405 (metG)
Enzymes [BR:hay01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     C3V42_08405 (metG)
Amino acid related enzymes [BR:hay01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   C3V42_08405 (metG)
Transfer RNA biogenesis [BR:hay03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    C3V42_08405 (metG)
 Prokaryotic type
   Other AARSs
    C3V42_08405 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 UME
Motif
Other DBs
NCBI-ProteinID: AVM60634
Position
complement(1754738..1756786)
Genome map
AA seq 682 aa AA seqDB search
MTTQPRKILVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNKIHFVCADDAHGTPIM
LNADKLGITPEELIAKAKADHVRDFAGFNISFDNYHSTHSEENKQLTAEIYNKLKANGFI
KSKVISQLFDPEKNMFLPDRFVKGTCPKCKAEDQYGDNCEVCASTYSPMDLINPRSAVSG
ATPVVKESEHFFFDLPAFEGMLKEWTRSGSLQSEIANKMQEWFESGLQQWDISRDAPYFG
FEIPGAKDKFFYVWLDAPIGYMASFKNLCNREGIDFNEFWAEGSDAELYHFIGKDIVYFH
SLFWPAMLEGSGYRKPTNVFTHGYVTVDGAKMSKSRGTFIQASTYLNHIDPECLRYYYAA
KLNDRIEDLDFNLEDFVQRVNTDIVNKLVNLASRNAGFIAKRFEGKLADKLEDESLFAEF
TAQAEQIAAYYESREYNKAIREIMALTDKANKYIDEKAPWVIAKEEGKEAELQAVCSMGI
ELFRVLMSYLKPVLPKLAERAEAFLQAELRWDNIHQPLLGHTLAPFKALFSRLEKKQIDA
VVEETKALFAAANKAAEKTEAKPTVLSAVEPIAETITIDDFAKLDMRVAKVLKCEAVPES
NKLLRFELDLGDHTRQVFSGIKAAYNKPEELEGRFVIMVANLAPRKMKFGVSEGMILSAG
TGGSDLFLLSADSGVTAGMQVK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaacctcgtaaaattttagtcacttgcgccttgccttatgccaatggggca
attcatttaggtcatatgttagaacatatccaagcggatatttgggtgcgttttcaacgt
atgcgtggcaataaaatccattttgtctgtgcagacgatgcgcacggtacgccgattatg
ctgaatgccgataaacttggcattacacctgaagaattaattgctaaagcaaaagccgat
cacgtgcgtgattttgcaggtttcaacattagttttgataactatcattccactcacagc
gaagaaaacaaacagctcactgcagaaatttacaataaactcaaagccaatggctttatt
aagagtaaagttatttctcagttattcgaccctgaaaaaaatatgttcttacccgatcgt
tttgtgaaaggcacttgccctaaatgtaaagcagaagatcaatatggcgataactgcgaa
gtttgtgcttctacttatagtccaatggatttaattaatcctcgctcagctgtttctggc
gcaacacctgtggtaaaagaatctgaacactttttctttgacttacccgcatttgaaggc
atgttaaaagaatggactcgttctggctcacttcaatctgaaattgcgaacaaaatgcaa
gaatggtttgaaagcggtttacaacaatgggatatttcacgcgatgcaccttatttcggt
tttgaaattccgggggcaaaagataaattcttctatgtttggttagatgcaccaatcggc
tatatggcttcattcaaaaatctatgcaatcgtgaaggcattgatttcaatgaattttgg
gctgaaggcagcgatgcggagctttatcatttcatcggtaaagacatcgtttatttccac
agtctattctggccagcaatgcttgaaggcagtggctaccgtaaaccgactaatgtgttc
actcatggctatgtcacggtggatggggcgaagatgtcaaaatctcgcgggacttttatt
caagccagcacttatttgaatcatatcgatcctgaatgtttgcgttattactatgcggca
aaattaaatgatcgcattgaagatttagactttaaccttgaagatttcgtacaacgtgtc
aatacggatattgtaaacaaattagtaaatttggcttcacgcaatgccggctttattgcg
aaacgctttgaaggcaaacttgcggataaattggaagacgaatcattatttgcagaattt
accgcccaagccgagcaaatcgctgcttactacgaaagccgtgaatacaataaagccatt
cgtgaaattatggcattaaccgataaagccaataaatatattgatgaaaaagccccttgg
gtaattgcaaaagaagaaggcaaagaggctgaattacaagccgtatgttcaatggggatt
gagcttttccgcgtgttgatgtcttacttaaaacctgttcttccaaaactggcagaacgt
gcagaagccttcttacaagctgaattacgttgggataatattcatcaaccactgcttggt
catacccttgcaccattcaaagccttattctctcgtttagagaaaaaacaaattgatgct
gttgtggaagaaaccaaagccttatttgcagcagccaacaaagccgcagaaaaaactgaa
gcaaaaccaaccgtactttctgctgttgaacctattgctgaaactatcactattgatgat
ttcgctaaacttgatatgcgtgtagcaaaagttttgaaatgcgaagcggtgccagaatct
aataaacttttacgttttgaattagatctcggcgatcatactcgtcaagtcttctctggc
attaaagcggcttacaataagcctgaagaattagaaggtcgttttgtgattatggtagca
aaccttgcaccacgtaaaatgaaatttggcgtgtctgagggaatgattctatccgcagga
acaggcggtagtgatttattcttgttatctgccgatagcggtgtcactgcgggcatgcaa
gtaaaataa

DBGET integrated database retrieval system