KEGG   Halothiobacillus sp. LS2: A9404_06520Help
Entry
A9404_06520       CDS       T04441                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
haz  Halothiobacillus sp. LS2
Pathway
haz00740  Riboflavin metabolism
haz00790  Folate biosynthesis
haz01100  Metabolic pathways
haz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:haz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    A9404_06520
   00790 Folate biosynthesis
    A9404_06520
Enzymes [BR:haz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     A9404_06520
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     A9404_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 V-SNARE_C
Motif
Other DBs
NCBI-ProteinID: ANJ67082
UniProt: A0A191ZGV4
Position
complement(1467758..1468927)
Genome map
AA seq 389 aa AA seqDB search
MSFSPIDDILDDLAAGRMVIIVDDEDRENEGDLLMLAEKVRPEDVNFMARFGRGLICLTL
TEARCNQLKLPLMVSQNREAFATAFTMSIEAATGVTTGISAADRARTIQVAVAEDAKPTD
IVQPGHVFPLMARPGGVLTRAGHTEAGIDLARLAGAREPAAVIVEILNDDGSMARRPDLE
RFAETHGLKIGSIEDLIRYRMKHERSIERVAETPLVTKQGAFRVMAYRDHSTGQTHLAVV
RGHPGPDHPVAVRVHVHHPVCDLLEPQDVDCGWPLSDVLTRLGQMSEGVAIILRPTIDEQ
DVLQQLRDWQAQADSQGANPNQVAPMRSKAPVDHVRTYGVGAQILKDLGVQRMRVMSAPK
RFHALAGYGLEVVDYIYDEAADVAVGEMQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagttttagccccatcgacgacattctcgacgacttggccgcaggccgcatggtgatc
atcgtcgacgatgaggatcgcgaaaacgagggcgacctcctgatgctcgcggaaaaggtc
cgtcccgaggacgtgaacttcatggcgcgattcggccgcggcctgatctgcctgaccctc
acggaggcacgctgcaatcagctcaagctgcccctgatggtgtcgcagaaccgcgaagcc
ttcgcgaccgccttcacgatgtccatcgaggcggcgaccggtgtgacgaccggtatttcg
gccgcggatcgcgcgcggaccatccaggttgccgtggcggaggacgccaagccgacggat
atcgtgcaaccggggcatgtatttcccctgatggcccgacctggcggggtgctgacccgt
gcggggcataccgaggcgggtatcgatctggcgcgcttggcgggtgcccgcgagccggcg
gcggtgatcgtggagatcctgaacgacgacggcagcatggcccgtcgtccggatctcgag
cggttcgccgagacccacggcctcaagatcggttcgatcgaggacctgatccgttaccgg
atgaagcacgagcggtcgatcgaacgggtggcagaaacgccgctggtcaccaagcagggg
gcattccgggtgatggcctatcgcgatcacagcacggggcagacccatctggccgtcgtc
cgcggtcatcccggccccgatcatccggtggcggtgcgggtgcatgtgcaccatcctgtc
tgcgatctgctggagccgcaggacgtcgattgcggctggccgctttcggatgtgctgacc
cggctcggacagatgagcgaaggggtcgccatcatcctgcggccgacgatcgatgaacag
gacgtgctgcaacaactgcgcgactggcaggcccaggcggacagtcagggggcgaatccg
aaccaggtagcgccgatgcgctcgaaggcaccggtggatcatgtccgcacctacggcgtg
ggcgcgcagatcctcaaggatctgggcgtgcagcgcatgcgggtgatgagcgcgccgaaa
cgatttcatgccttggccggttacggtctcgaggtggtcgattatatttatgacgaggcc
gcagacgtggccgtgggagaaatgcaatga

DBGET integrated database retrieval system