KEGG   Hirschia baltica: Hbal_0403Help
Entry
Hbal_0403         CDS       T00945                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
hba  Hirschia baltica
Pathway
hba00473  D-Alanine metabolism
hba00550  Peptidoglycan biosynthesis
hba01100  Metabolic pathways
hba01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hba00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Hbal_0403
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Hbal_0403
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Hbal_0403
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hba01011]
    Hbal_0403
Enzymes [BR:hba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Hbal_0403
Peptidoglycan biosynthesis and degradation proteins [BR:hba01011]
 Precursor biosynthesis
  Amino acid ligase
   Hbal_0403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 GARS_A Ins134_P3_kin_N CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ACT58105
UniProt: C6XMG2
Position
432071..432979
Genome map
AA seq 302 aa AA seqDB search
MNRVAVIMGGWSSEREVSLSSGRGMAQAARNEGFDVVEIDITRDLSNQLKEANPDVVLNA
LHGPYGEDGCVQGLLEILEIPYSHSGVLASALAMDKAKSRNVYARMGLLVAEGGVYAKED
VAAEHVMKPPYVVKPIAEGSSFGVLIVPEGANRPPAELLDPKWGFGDSVLVEQFIPGREL
TVSVMGNEALAVTEITTLRDYYDYSAKYEAGGSKHVIPAEISDAVTQAALDAALIAHDAL
GCRGVSRSDFRYDDDTKRLVILETNTQPGMTPTSLVPEQAAHKGISYEKLVRWMIEDASC
HR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcgtagcagtcataatgggtggatggtcatcggagcgagaagtctcgttatcg
tctggccgtggtatggcgcaagctgcccgcaatgaaggtttcgacgttgttgaaatagat
atcacgcgtgatttatccaatcagctaaaagaagctaatccagacgtcgtactgaatgcg
ctgcatggcccgtatggagaagatgggtgcgtacaggggctgttggaaattcttgagata
ccttattcgcattcaggtgttttggcttcagctttagcaatggacaaagccaaatctcgc
aatgtttatgcgcgtatggggctgcttgtcgctgagggcggcgtctatgcaaaagaagat
gttgccgcagaacatgtgatgaagccgccttatgttgtaaaacctattgcggaagggtct
tcttttggtgtgttgattgtgcctgaaggggctaatcgcccaccagcagaattacttgat
cctaaatggggctttggcgactctgttttagtcgaacaattcattcctggacgagaatta
accgtatcagtcatgggaaatgaagctttagcggtcacagagatcacgactttaagagat
tattacgattactcagccaaatatgaggcgggaggatcaaaacacgtaattcctgcagaa
atatctgatgcagtgacacaagccgcgcttgatgccgcgcttatcgctcatgatgcatta
gggtgtcgcggcgtatcacgttctgattttcggtatgatgacgacacaaaaagattggta
atattagaaacaaatacccagccaggcatgaccccgacttcgcttgtacctgaacaggca
gcgcataagggcattagttatgagaagctggtacgttggatgatagaggacgcttcatgt
cacaggtga

DBGET integrated database retrieval system