KEGG   Hirschia baltica: Hbal_1973Help
Entry
Hbal_1973         CDS       T00945                                 

Definition
(GenBank) glycoside hydrolase family 5
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
hba  Hirschia baltica
Pathway
hba00500  Starch and sucrose metabolism
hba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hbal_1973
Enzymes [BR:hba01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Hbal_1973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase Peptidase_M73 Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: ACT59657
UniProt: C6XKU0
Position
complement(2125995..2127035)
Genome map
AA seq 346 aa AA seqDB search
MKQIWWGLLGAVFSVCTIGGGYAYVHQSEDSQSSYSAHQLALPESPISRCINMGNALDAP
NEGDWTYIIKDEHLQEIGKAGFETIRLPIRWSAHTQKEAPYIIDPAFFARVEHVVNVALL
NGLKVIIDVHHYEEIMQTPSAHIDRLDAMWRQISRRFRGHGENIIFEVLNEPMAELTSKE
LIPLNARMVATIRNNAGSDPWIMLGGDHWGNFSGLKKMRFPYDPRIIVTFHDYGPFEFTH
QGASFTAKDYPTGRVWGTEQERKDVISLFSEARQLGAELRKPIFLGEFGVYKRVPESERA
KWIKYYRQSAEDAGIGWCLWDFGAAFAIYDEETKSWSPPILEALFD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatttggtggggattgttgggggccgttttttctgtctgcactattggcggt
ggatatgcctatgtacatcagagtgaagattcacaatcttcctattccgcacaccagctg
gcgcttcctgaaagtccgatttcgcgctgtatcaatatggggaatgctcttgatgcgccc
aatgaaggcgattggacatacattattaaagatgagcatctgcaagaaattggcaaagca
ggttttgaaactattagattaccgattaggtggtcagctcatactcaaaaagaagcaccc
tatataatagacccagccttttttgcgcgtgtagaacatgtcgtcaatgtcgcgcttcta
aacggtctgaaggttattattgatgtgcatcattatgaagaaatcatgcagacgccatcc
gcacatattgaccgtttggatgcaatgtggcgacaaatatccagaagatttcgcgggcat
ggcgaaaatattatttttgaagtgctcaatgagccaatggctgagctaacgagcaaagaa
ttgatcccattgaatgcgcgaatggttgcaaccatcagaaataatgctggaagcgatcct
tggattatgctcggcggagatcattggggaaatttctctggccttaaaaaaatgcgcttt
ccttatgatccgcgtataatcgtgacttttcatgattacggtccgtttgaatttacgcat
caaggtgcaagctttactgcgaaagattatccaacaggcagagtgtgggggacagagcaa
gagcgaaaagatgtgatttccttattcagtgaagctcgtcagttgggggcagagttgaga
aaaccaattttcttaggagaatttggcgtttacaaacgggttcctgaaagcgaacgcgct
aaatggattaagtattaccgtcaatctgcagaggatgccggcattggttggtgtttgtgg
gattttggtgctgcttttgccatctatgacgaagaaaccaaatcttggtctccgcctatt
ttagaagctctttttgattaa

DBGET integrated database retrieval system