KEGG   Hirschia baltica: Hbal_2346Help
Entry
Hbal_2346         CDS       T00945                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hba  Hirschia baltica
Pathway
hba00260  Glycine, serine and threonine metabolism
hba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hba01100  Metabolic pathways
hba01110  Biosynthesis of secondary metabolites
hba01130  Biosynthesis of antibiotics
hba01230  Biosynthesis of amino acids
Module
hba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbal_2346
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hbal_2346
Enzymes [BR:hba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hbal_2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACT60026
UniProt: C6XMW2
Position
complement(2500466..2501680)
Genome map
AA seq 404 aa AA seqDB search
MDTRNTWNKWPDESGRFGEFGGRYVAETLMPLILDLEKEYEAAKADPEFEKLYRGLMQDY
VGRPSAMYFAERLTEHFDGAKIYFKRDELNHTGSHKVNNCLGQVLLALRMGKTRIIAETG
AGQHGVATATICARFGLPCTVFMGATDVERQKPNVFRMKLLGAEIVPVSSGTGTLKDAMN
EALRDWVTNVHDTFYCIGTAAGPHPYPAMVRDFQSVIGREAKAQIMEREGRLPDVVMACI
GGGSNAIGLFHPFLEDENVRMIGVEASGHGIETGEHAAALNGGEPGILHGNRTYLLQDGD
GQIIDAHSISAGLDYPGIGPEHSFLKDTGRAEYLTCTDKEALDAFQLCTKLEGIIPALEP
AHAIARVGDVARELGKDGLIIMNLCGRGDKDVFSVAGHLGIDID
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggacacgcgcaatacttggaataaatggcctgacgaaagcggacgttttggagagttt
ggtggacgctatgttgccgagactttaatgccgcttatcctcgatcttgaaaaagaatac
gaagctgcaaaagcagacccggaatttgaaaagctatatcgaggcttgatgcaggattat
gtggggcgtccatcggcaatgtattttgctgaacgcttaacagagcattttgatggtgcg
aaaatatatttcaagcgggatgaactaaaccatacaggatcacacaaggtgaataactgt
ctggggcaagtactattggctttgcgcatgggcaagacccgcattattgctgaaactgga
gcagggcagcacggcgtggcaacagctactatctgtgcacgctttggacttccatgtact
gtgtttatgggggcgactgatgtagagcgccaaaaaccaaatgtgttccgcatgaagcta
ttgggcgctgaaattgtacccgtatcatcaggaacaggcacgctgaaagacgcgatgaat
gaagcattgcgcgattgggtgacgaatgtgcatgatacattttattgtatcgggacagcc
gctggtccacacccatacccagctatggtgcgtgatttccaatctgtcattggccgtgaa
gctaaagcacagattatggaacgcgaaggtcggcttccagatgttgttatggcgtgtatt
ggcggcggatctaacgcgataggattattccatccattcttagaagatgaaaacgtaaga
atgatcggtgtggaagcatcaggccatggtatcgagacaggcgagcacgcggcagccctc
aacggcggagagccgggtatcctgcatggaaatcgcacatatctgcttcaagatggtgat
gggcagattatagatgcgcattctatctctgcagggttggactatccgggtatcggacct
gagcattccttcctgaaggatacaggccgcgctgaatatctgacatgcactgacaaagag
gctctggatgcttttcagctatgtacaaaactagaaggtatcattcccgcgcttgaaccc
gcacacgcaattgcgcgcgttggtgatgttgctagggagttgggtaaagatggcctcatc
ataatgaacttatgtgggcgtggtgataaagatgtattctctgtcgcgggtcatcttgga
attgatattgattag

DBGET integrated database retrieval system