KEGG   Hirschia baltica: Hbal_2835Help
Entry
Hbal_2835         CDS       T00945                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hba  Hirschia baltica
Pathway
hba00071  Fatty acid degradation
hba00072  Synthesis and degradation of ketone bodies
hba00280  Valine, leucine and isoleucine degradation
hba00310  Lysine degradation
hba00362  Benzoate degradation
hba00380  Tryptophan metabolism
hba00620  Pyruvate metabolism
hba00630  Glyoxylate and dicarboxylate metabolism
hba00640  Propanoate metabolism
hba00650  Butanoate metabolism
hba00900  Terpenoid backbone biosynthesis
hba01100  Metabolic pathways
hba01110  Biosynthesis of secondary metabolites
hba01120  Microbial metabolism in diverse environments
hba01130  Biosynthesis of antibiotics
hba01200  Carbon metabolism
hba01212  Fatty acid metabolism
hba02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hbal_2835
   00630 Glyoxylate and dicarboxylate metabolism
    Hbal_2835
   00640 Propanoate metabolism
    Hbal_2835
   00650 Butanoate metabolism
    Hbal_2835
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hbal_2835
   00072 Synthesis and degradation of ketone bodies
    Hbal_2835
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hbal_2835
   00310 Lysine degradation
    Hbal_2835
   00380 Tryptophan metabolism
    Hbal_2835
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hbal_2835
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hbal_2835
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Hbal_2835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hba04147]
    Hbal_2835
Enzymes [BR:hba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Hbal_2835
Exosome [BR:hba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hbal_2835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACT60508
UniProt: C6XQX7
Position
complement(3135773..3136951)
Genome map
AA seq 392 aa AA seqDB search
MREAVIVSTARTPIGRAYKGAFNNTPSPTLAGHAIKNAVERAGIDGAEVEDVVFGAALQQ
GVQGGNIARNATLRSGLPVTVSAQSLDRQCASGMMAIATAAKQVVLDGMDVAIGGGVESI
SMVQTPELRMKADPELLAMHPKAYISMIETAEIVSARYGISREAQDEYALQSQQRTAAAQ
AAGAFDQEIVPMASKMLVKDKATGDISEKAVTLEKDEGNRPETTLEGLNSLKPVVGPDAF
ITAGNASQLSDGASASVIMEAKLAEKRGLSPLGIYRGMAVAGLEPDEMGIGPVFAIPKLL
KANGLTMDDIGLWELNEAFACQVIYCRDKLGIPDELLNVNGGAISVGHPYGMSGARMTGH
ALIEGKKRGAKYVVCTMCVGGGMGAAGLFEVA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagcagttattgtttccacggcgagaacgccaattggacgcgcctataaaggg
gcgttcaacaatacaccttcgccaacgcttgcggggcatgcaatcaaaaatgccgtcgaa
cgtgcgggtattgacggtgctgaagtggaagatgttgtctttggtgcagcgcttcaacaa
ggcgtgcagggcggcaatattgcgcgtaatgccacattacgctcaggcctacctgtgact
gtgtctgcgcaaagccttgaccgtcaatgtgcgtctggcatgatggccattgcaacagcg
gctaagcaggttgtgcttgatggtatggatgtggctattggcggcggtgttgaatccatc
tctatggttcaaacgccagaattgcgcatgaaagcagacccagaattgctggccatgcac
cccaaagcgtatatctcaatgatcgaaactgccgaaatcgtcagcgcgcgttatggtatt
tcccgtgaagcacaagacgagtatgcgctgcaatcacagcaacgcacggctgcggctcag
gctgctggcgcatttgatcaagagatcgtgccaatggcatctaaaatgctggtcaaagat
aaagcgactggcgacatttcagaaaaagcagtgacccttgaaaaagacgaaggcaaccgt
cctgaaacaacactagaaggtctaaacagccttaagccagttgttgggccagatgctttc
atcacagcgggaaatgcgtctcaattgtctgatggtgcatctgcatctgtcatcatggaa
gccaagctcgctgaaaagcgcggcttgtctcctttgggtatctatcgcggcatggctgtc
gcaggtcttgagcctgatgaaatgggtattggtccagtgtttgccattcctaagctttta
aaagctaatggcctgacaatggatgatattgggctatgggaactcaacgaagcatttgca
tgtcaggttatctattgccgtgacaagcttggcattcctgatgaacttttaaatgtgaat
ggcggcgcgatttcggtgggtcacccatatggaatgtctggtgcccgcatgacaggacac
gcgcttatcgaaggtaagaagcgcggcgcaaaatatgttgtctgcacaatgtgtgttggc
ggcggaatgggcgcagccggcctctttgaagttgcctaa

DBGET integrated database retrieval system