KEGG   Hirschia baltica: Hbal_2927Help
Entry
Hbal_2927         CDS       T00945                                 

Definition
(GenBank) phage shock protein A, PspA
  KO
K03969  phage shock protein A
Organism
hba  Hirschia baltica
Brite
KEGG Orthology (KO) [BR:hba00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99998 Others
    Hbal_2927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PspA_IM30 Spc7 BLOC1_2 ExsD
Motif
Other DBs
NCBI-ProteinID: ACT60596
UniProt: C6XR65
Position
3228626..3229294
Genome map
AA seq 222 aa AA seqDB search
MGIFSRFGDIINSNLNAMLDKAEDPEKIARLIIQEMEDTLVEVRTAAARTMADKKELQRE
MRELQIVRDDWSAKAELAIEKDREDLARGALSAKQRAEREIESRKSALAAVDDAAAKRQD
DLGKLQAKLEEAKTKHRALMVRRQAAEERIKVRSRIDDSKVDDALHRYAAVERKVDELEA
YADTYDLKSKTLESEFADLEASESVELELAAMKARKKSGSDN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgggaattttttctcgctttggagacatcataaactcaaatctgaacgccatgctcgac
aaggctgaagaccctgagaaaatcgcacgtctaatcattcaagaaatggaagacacactt
gtagaagtccgcacagccgcagcccgcacaatggcagacaaaaaagaacttcaacgcgaa
atgcgtgaacttcaaattgtccgcgatgactggtctgcaaaagcagaactcgcaatcgaa
aaagaccgcgaagaccttgcacgtggcgctctctcagcgaaacaacgcgccgaacgcgaa
atcgaaagccgcaaatcagcccttgctgcagtcgatgatgccgccgcaaaacgtcaggat
gatcttggcaaacttcaagccaaacttgaagaagctaaaaccaagcaccgcgctttgatg
gtccgccgccaagcagctgaagaacgcatcaaagttcgctcacgcattgatgattcaaaa
gttgatgacgcattgcaccgctacgcagcagttgagcgcaaagtcgatgaattagaagct
tatgccgacacatacgacctcaaaagcaaaacacttgaaagtgaatttgcagaccttgag
gcctcagaaagtgtcgaattggaattagccgccatgaaagcgcgcaagaaatcaggatcg
gataactaa

DBGET integrated database retrieval system