KEGG   Hyphomonadaceae bacterium UKL13-1: AEM38_01340Help
Entry
AEM38_01340       CDS       T04338                                 

Definition
(GenBank) hypothetical protein
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
hbc  Hyphomonadaceae bacterium UKL13-1
Pathway
hbc00460  Cyanoamino acid metabolism
hbc00500  Starch and sucrose metabolism
hbc01100  Metabolic pathways
hbc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AEM38_01340
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    AEM38_01340
Enzymes [BR:hbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     AEM38_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: AMS30688
Position
complement(294565..295914)
Genome map
AA seq 449 aa AA seqDB search
MRFPESFVFGASTAAYQIEGAAQTDGRGEGIWDRYSHTPGKIHQGDTGDIACDHYHRFEE
DLDLAQAASMTAYRFSINWARVLPDGVGRVNEAGLAFYDRLVDACIARGLEPWVCFYHWD
YSQVLQDQGGWANRASVDWFLELVQLVTNHLKDRVTDWCLFNEPTIFTSLGYLLGQHAPG
LKDPAAYGAAVHHVSLATADGVRLVRRLAPGAKVGTVLSINGVQPASTSPEDMAASALAD
AIMNRAFLDPIFKGTYPDEIGAMVTPFIRDGDMDRLKADLDFLGINHYTRSKIAAKPASV
SADGATAGGGMGFVPPPAGTPVTLMGWEIRPEGIYEVIARVYEQYAALPIYITENGGAFP
DEMTATGDVLDHDRIGLLTGYLSQIARAIDDGYDVRGYLVWSLLDNFEWGHGYSKRFGLV
HVDYESQKRTPKASYQWYRQLAQSRTIAN
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
attcgctttcccgaaagtttcgtctttggcgcttcaaccgccgcttatcaaattgagggt
gccgcccaaaccgatggtcgcggggaaggcatttgggaccgttattcccatacacccggt
aaaatccatcagggcgatacgggcgatattgcttgtgatcactaccaccgctttgaagaa
gatctcgatctagcccaagcggccagcatgacggcctatcgcttctcgatcaattgggcg
cgcgttttgcccgatggtgttggacgggtgaatgaagccgggctggccttctatgatcgg
ctggtggatgcgtgcatcgcgcgcggcttagagccttgggtctgcttttatcactgggat
tattctcaagttttacaagaccaaggcggctgggccaaccgtgcatcggtggattggttt
ctagaattggttcagcttgtcaccaatcacttgaaggaccgcgtcaccgattggtgcctg
tttaacgagccgacgatattcacctcgctcggctatctattgggccaacatgcccccggc
cttaaggaccccgctgcttatggcgccgccgtgcaccatgtcagcctggcaaccgcagac
ggcgttcgcctcgtgcgccgtctggccccaggcgcaaaggtcggcaccgtactctcgatc
aatggcgtgcagcccgcctcgacaagcccagaagatatggccgccagcgcgttagccgat
gccatcatgaaccgcgccttcctagatccgatcttcaaggggacataccctgatgagatc
ggggccatggtcaccccgttcattcgcgacggcgacatggaccgcctgaaggcagatttg
gatttcctcggtatcaatcactatacgcgctcaaaaattgcggcaaagcctgccagcgtg
tctgccgatggcgcgactgcgggcggcggcatgggctttgtacccccgccagctggaacg
cccgtgaccttgatggggtgggaaatccggccagagggcatttatgaagtgattgcccgc
gtttatgagcaatatgccgcgctgcccatctatatcaccgaaaatggcggtgccttcccc
gatgaaatgaccgccactggcgacgtgctcgaccatgaccggattggcttgctaacaggc
tatctcagccaaatcgcgcgcgcgattgacgatggctatgatgtacgaggctatctggtt
tggtcactccttgataattttgaatgggggcatggctattccaagcgatttggcttggtg
catgtggattacgaaagccagaagcgcacgccaaaggccagctatcagtggtaccgccag
ctggcccagtcccggacaatcgcgaactga

DBGET integrated database retrieval system