KEGG   Hyphomonadaceae bacterium UKL13-1: AEM38_01720Help
Entry
AEM38_01720       CDS       T04338                                 

Definition
(GenBank) hypothetical protein
  KO
K06195  ApaG protein
Organism
hbc  Hyphomonadaceae bacterium UKL13-1
Brite
KEGG Orthology (KO) [BR:hbc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AEM38_01720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 LTD
Motif
Other DBs
NCBI-ProteinID: AMS28489
Position
386990..387388
Genome map
AA seq 132 aa AA seqDB search
MTQYSATTRGVRIQVTPVFLDDQSDPEENDFVWAYTVEIANLSEQTVQLTARTWKIIDHH
GVTQVVQGPGVVGEQPILREGDSFTYTSGCPLSTPSGLMMGSYLMQTDDGETFEAQVPAF
SLDSPFEIRSVN
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgacccaatattccgccacgactcgcggtgtccgcatacaggtgacgccggttttcctc
gacgatcaatctgatcccgaggagaatgatttcgtgtgggcctatacggtcgagatcgcc
aatctgtcagagcaaaccgtgcaactgacggcgcgtacgtggaagattatcgaccaccat
ggcgtcacccaagtcgtgcagggcccgggcgttgtcggcgaacagccgatcctgcgcgaa
ggcgatagcttcacttacacctccggctgccccctttcgacgccctctggcttgatgatg
ggcagctatctgatgcagaccgacgacggcgaaacctttgaagcccaagtccccgccttt
tcgctcgacagcccgtttgaaatccgtagtgtgaattaa

DBGET integrated database retrieval system