KEGG   Hyphomonadaceae bacterium UKL13-1: AEM38_06275Help
Entry
AEM38_06275       CDS       T04338                                 

Definition
(GenBank) hypothetical protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
hbc  Hyphomonadaceae bacterium UKL13-1
Pathway
hbc00260  Glycine, serine and threonine metabolism
hbc00630  Glyoxylate and dicarboxylate metabolism
hbc00670  One carbon pool by folate
hbc01100  Metabolic pathways
hbc01110  Biosynthesis of secondary metabolites
hbc01130  Biosynthesis of antibiotics
hbc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AEM38_06275
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AEM38_06275
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AEM38_06275
Enzymes [BR:hbc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     AEM38_06275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AMS29150
Position
1351876..1353036
Genome map
AA seq 386 aa AA seqDB search
MSEDTSLKTTPLTGLWQSMGGRMVPFAGYLMPVQFPEGVMKEHVWTRESCGLFDVSHMGP
AFLALNETSLAGDAAHAAIAALVETILPCDVAGLAPGQLRYTTLPNASGGVLDDLFVGRP
KADADQGTLYFVVNAGCKEQDFAIIAEACAGKATLTRADDRALIAVQGPKAVDAIGNVGD
GPKRLSFMEFATVKGPYGEVVVSRSGYTGEDGFEVLIAADKAEAFVRTLLATAHVKAIGL
GARDSLRLEAGLCLYGHDLDETTSPIEAGLAWTIQKVRRERGDFPGAARILKELAEKPSR
KRVGLLPKDKAPAREGAEIRNLAGEKVGMVTSGGYGPSVGGPIAMGYVDAAFAAVGTELD
LIVRDQPRRWVVAPLPFVPHNYHRKG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagatacttccttaaaaaccacacccctaacagggctctggcaaagcatgggc
ggccgcatggtgccctttgctggctatctgatgccggttcagtttccagaaggcgtgatg
aaagaacatgtgtggacgcgcgagagctgcggtctgtttgatgtctcgcacatgggcccg
gcctttttggcgctcaatgaaacaagtctggccggcgatgccgcccatgcggcaattgcg
gccttggtggaaaccattctgccgtgcgacgttgcgggccttgcccccggtcagttgcgc
tataccactttaccaaatgccagcggtggcgtgctggacgatttgtttgttggccgcccg
aaggcagatgccgatcaaggcacgctctattttgtcgtcaatgccggctgcaaagaacaa
gactttgcgatcatcgcagaagcctgcgctggcaaagcgacgctaacgcgcgccgatgac
cgcgccttgatcgcggtacaggggcctaaggcggtggatgccattggcaatgttggcgac
gggccaaagcgcttgagctttatggaatttgccacggtgaaaggcccctatggcgaagtc
gtcgtttcccgctctggctatacgggcgaagacggctttgaggtgctgattgccgccgat
aaggctgaagcctttgtgcgcaccttgttggccaccgcgcatgtcaaagccattggcctt
ggcgcgcgcgatagtctgcgcctagaggcgggtctttgcctctacggccatgacttggat
gagaccaccagcccgattgaagcaggccttgcttggaccattcagaaagtgcggcgcgag
cgtggcgattttccaggcgctgcgcgaattctgaaggagctcgccgagaagccaagccgc
aaacgcgttggcctcttgcccaaggataaggcacccgcacgtgaaggcgctgaaatccgc
aatctggctggcgaaaaggtcggcatggtcacatctggcggctatggccccagcgtcggt
gggccgattgccatgggttatgttgacgcggcctttgccgcggtcggcactgaattggat
ttgatcgttcgcgatcaaccccgccgctgggtcgtcgcgcccttaccttttgttccccat
aattaccaccggaaaggctga

DBGET integrated database retrieval system