KEGG   Hyphomonadaceae bacterium UKL13-1: AEM38_08325Help
Entry
AEM38_08325       CDS       T04338                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hbc  Hyphomonadaceae bacterium UKL13-1
Pathway
hbc00071  Fatty acid degradation
hbc00072  Synthesis and degradation of ketone bodies
hbc00280  Valine, leucine and isoleucine degradation
hbc00310  Lysine degradation
hbc00362  Benzoate degradation
hbc00380  Tryptophan metabolism
hbc00620  Pyruvate metabolism
hbc00630  Glyoxylate and dicarboxylate metabolism
hbc00640  Propanoate metabolism
hbc00650  Butanoate metabolism
hbc00900  Terpenoid backbone biosynthesis
hbc01100  Metabolic pathways
hbc01110  Biosynthesis of secondary metabolites
hbc01120  Microbial metabolism in diverse environments
hbc01130  Biosynthesis of antibiotics
hbc01200  Carbon metabolism
hbc01212  Fatty acid metabolism
hbc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AEM38_08325
   00630 Glyoxylate and dicarboxylate metabolism
    AEM38_08325
   00640 Propanoate metabolism
    AEM38_08325
   00650 Butanoate metabolism
    AEM38_08325
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AEM38_08325
   00072 Synthesis and degradation of ketone bodies
    AEM38_08325
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AEM38_08325
   00310 Lysine degradation
    AEM38_08325
   00380 Tryptophan metabolism
    AEM38_08325
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AEM38_08325
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AEM38_08325
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AEM38_08325
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hbc04147]
    AEM38_08325
Enzymes [BR:hbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AEM38_08325
Exosome [BR:hbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AEM38_08325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AMS30922
UniProt: A0A142LFC6
Position
complement(1788123..1789688)
Genome map
AA seq 521 aa AA seqDB search
MIDPNTPVLIGGGQFTYRGAPESCPPPIGLCARAAEAAIADSGLNHEILAKIDGLAVVGF
TIDAGGNLSRMPIPKAKNPPKALAKVLGASPAWQTYTHVGGNTPQALVNEAAERIANGDN
KLVLLAGAEFLGSMMKLVQASNFGPLAAYQVDDEEAPAMFGDGRDGCSPYEARHGLEFPT
NVYPMFENAYRANLGRSLEAHSTAMGALFAPFTEVAAQNPYAWFPQAQTAEALVTPSASN
RMVGFPYPKRLNAIIQVDQSAAVLMASYAHAKSLGVPESQMVFLHGCADTIEKWNVLDRV
DYHSSPAMRVGVREAFAMAGKSLADMSFFDLYSCFPVAVEIAAKEMGLATDDPRGLTLTG
GLPYFGGPGNNYSMHGIVEMIHRCRKEPDAFGFLNANGWFLTKHAFGIYSCQPTMGAWAR
PSKKSYQGEIDAMASPEVTETPTGAAMIETYTVIHAREGMRMGIVIGRDEAGRRFVANTP
KGDTDIMADLEGRESVGRKGQVVHDGERNIFTPQEFLGSVV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatccaaacacgcctgtcctgattggcggaggccaattcacctatcgcggtgcc
cccgaatcctgtccgccgccaattggcctgtgcgctcgcgcggcagaagcggcgattgcc
gattctggcctaaaccacgagattttggccaaaattgacggtttggcggtggttggcttt
acgattgatgccggtggcaatctaagccgcatgccaatccccaaggcgaagaacccgcca
aaagcgctagccaaggtactaggcgcttctcctgcgtggcagacctacacccatgtcggc
ggcaatacgccgcaagccttggtcaatgaagctgctgaacgtatcgccaacggcgacaac
aagctggtcctcttggcaggcgctgagtttttaggctccatgatgaagctggtacaggcg
agtaattttggcccacttgccgcctatcaggtcgatgacgaggaagccccagccatgttt
ggcgatgggcgcgacggctgttcgccctatgaagcccgtcatggcctcgagtttccgacc
aatgtgtatccgatgtttgaaaatgcctatcgggcaaatctggggcgcagtttagaggcg
cattcgacggcgatgggggctttgtttgcgcccttcaccgaagtggccgcgcaaaatccg
tatgcgtggttcccgcaagcccagacagcggaagccttggtgacgcccagcgccagcaac
cgcatggtgggctttccatacccgaagcgcctcaatgccatcatccaagttgaccagtcg
gccgccgttttgatggccagctatgcccatgccaagagccttggcgtgcccgagtcgcag
atggtcttcctgcatggctgtgctgatacgattgagaaatggaatgtgctcgaccgcgtc
gattatcattccagccctgccatgcgggtgggcgtgcgcgaagcttttgcgatggcgggc
aagagccttgctgatatgtctttcttcgatctgtattcttgcttccccgtcgctgtcgaa
atcgctgcaaaggaaatgggccttgcgaccgatgatccgcgcggtctgaccttgacgggg
ggcttgccctattttggcggacccgggaataattattccatgcatggcatcgtcgagatg
atccatcgctgccgcaaagagcctgatgcgtttggcttcttgaacgcaaatggctggttc
ctgactaagcatgcctttggcatttattcctgccagccgaccatgggcgcttgggcaagg
ccgtctaagaaatcctatcaaggtgaaatcgacgcgatggcctcgcccgaggtgacggag
accccaacaggggccgccatgattgaaacctataccgtcatccatgcccgtgaaggcatg
cgtatgggcattgtgattggtcgcgatgaggcagggcgtcgctttgttgccaatacgcct
aagggcgataccgacattatggccgatctggagggccgcgaaagcgtgggccgtaagggc
caggtcgtccatgatggcgaacgcaatattttcacgccgcaagaatttttgggatctgtg
gtctag

DBGET integrated database retrieval system