KEGG   Hyphomonadaceae bacterium UKL13-1: AEM38_08675Help
Entry
AEM38_08675       CDS       T04338                                 

Definition
(GenBank) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
hbc  Hyphomonadaceae bacterium UKL13-1
Pathway
hbc00260  Glycine, serine and threonine metabolism
hbc01100  Metabolic pathways
hbc01110  Biosynthesis of secondary metabolites
hbc01120  Microbial metabolism in diverse environments
hbc01130  Biosynthesis of antibiotics
hbc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AEM38_08675
Enzymes [BR:hbc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AEM38_08675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 PUB_1
Motif
Other DBs
NCBI-ProteinID: AMS29513
Position
complement(1859436..1860458)
Genome map
AA seq 340 aa AA seqDB search
MFGSDNQASAHPRVLEAMLAANSGRCGSYGDDPWTVRALDLLYQVFETRDLDAYFVGTGG
AANGLALSALCPPWAAIMAHPHAHVLEDEGNGPEFFTSGSRLAALGSTGLLVQPEEIEAA
AARHSPDFVHGLQPRAVTLTNLSESGQAYSPDHLRAISAVCAKQGWVLHVDGARFANVVA
GTGASASDLSWRAGVDALSFGLTKNGAVAAEILILFGKARTEAAAYLRKRAGQLFSKHRY
LAAQAVAMLEDGLWLNLAGHANQMARDLGAGFERAGASLAAPVHGNEVFVRLDASKVAEL
QSAGISFYPWTTLGPDTYRFVASWQTSAEDVELVAKVLAD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtttggctctgacaatcaggcatcggcccatccacgcgtcttagaagccatgctggcc
gctaattcggggcgctgtggcagctatggcgatgatccgtggaccgtccgggctctcgac
ctgctttatcaggtgtttgagacccgcgacctcgatgcctattttgtcggaaccggtggg
gcagccaatggcttggccttgtcggccctttgcccgccttgggcagcgatcatggcccat
ccccatgctcatgtgctggaggatgaaggcaatggtcctgaatttttcaccagcggctct
cgcctcgcagcgttgggctcaaccgggcttctggttcagccagaagagattgaggctgcg
gccgcgcgccatagcccagatttcgttcatggccttcagccccgtgcggtgactttgacc
aatttgagtgaaagtgggcaggcctatagccccgatcatttgcgggccatcagtgccgtg
tgcgccaagcaaggctgggttctccatgtagatggcgcacgttttgccaatgttgtggca
ggaacaggggcttcagccagtgacttatcctggcgggcaggggtggatgccttaagtttc
ggtttgaccaagaatggtgctgtggcagcggaaatcctgatcttgtttggcaaagcgcgc
accgaggctgctgcctatttgcgcaagcgcgctggccaacttttctccaagcaccgctat
ttggcggcacaggcggtagccatgctggaggatggcctgtggctgaacctcgcgggtcac
gccaatcagatggcacgcgatctgggtgcaggctttgagcgggctggggcaagcctagcc
gcccctgtgcatggcaatgaagtgtttgtacgcctcgatgccagcaaagtagccgagctc
cagtctgcagggattagcttttatccgtggacaactttgggtccagatacttaccgattc
gtagcctcatggcagacctcggctgaagatgttgagttggtcgcaaaagtgctggcggac
tag

DBGET integrated database retrieval system