KEGG   Hyphomonadaceae bacterium UKL13-1: AEM38_13170Help
Entry
AEM38_13170       CDS       T04338                                 

Definition
(GenBank) hypothetical protein
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
hbc  Hyphomonadaceae bacterium UKL13-1
Pathway
hbc00051  Fructose and mannose metabolism
hbc00520  Amino sugar and nucleotide sugar metabolism
hbc01100  Metabolic pathways
hbc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AEM38_13170
   00520 Amino sugar and nucleotide sugar metabolism
    AEM38_13170
Enzymes [BR:hbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AEM38_13170
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     AEM38_13170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: AMS31072
Position
complement(2821810..2822886)
Genome map
AA seq 358 aa AA seqDB search
MHTHSPLITPVILSGGAGSRLWPLSTQTKPKQFHALAGAVTMFGQTLKRVAADQAAQFGA
PVVICGLSHFGPVSEELARENVTDATIVLEPKPRNTAPALAVAALIQAERDPEALMLVLP
ADHVIARPENLHRACLNACAAALDGRIVTFAVTPTAPETGYGYIKSGEALGEGVFAVEAF
REKPDLATAEAYLADGHYAWNAGIFFFKASAFLAELELYAPEVLVAAREALAQGRRDEGC
VFLDEAAFVKAPSLSVDYAVMEPTDRAAVVPVDMGWNDVGSFLTLWDLAEKDANDNVSQG
PTALFDTQGCLVRSEETPVALIGVEDLVVIATAQGILVMHKDRAQDVRLAADAFKAKS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atacatacgcattcaccgttgattacgcctgttatcttgtcaggtggcgcggggtcgcgt
ctttggcctttgtctacccagaccaaacccaagcagtttcatgcgctagctggcgctgtt
acgatgtttggacaaaccctgaagcgagtagctgctgatcaggcggcgcaattcggcgcg
ccagtggtcatttgtggccttagtcatttcggccctgtaagtgaagaattagcgcgcgag
aatgttactgatgctaccatcgtgcttgagcccaagccgcgtaatacagcccccgcgctc
gcggtagcggcccttatccaggcagagcgtgatccagaagcgctcatgttagttttgccg
gccgaccacgtaattgctcgcccagagaatttgcatcgggcctgtttgaatgcctgcgca
gcggccttagacggtcgtatcgttactttcgccgtgacccctactgcgcccgaaactggc
tatggctatattaagagcggtgaagcgctcggtgaaggtgtgtttgcggtagaagctttc
cgtgaaaagcctgacttggcaacggccgaggcttatctggccgatgggcattatgcttgg
aatgcgggcatattctttttcaaggccagcgcctttttggcagaacttgaactgtatgcc
ccagaggttttggtagctgcacgggaggcgctcgcccaaggtcgccgagatgaggggtgc
gtttttttagacgaggctgcgtttgtaaaagccccatctctctcggttgattacgcggtc
atggagccgaccgaccgtgcggcagtggtcccggtggatatgggctggaatgatgttggt
tccttcctgacactctgggatttggccgaaaaggacgccaacgacaatgtctctcaggga
ccaacagccttgttcgatacacaaggctgcctcgtgcgttcagaggaaaccccggttgcc
ttgatcggcgtggaagacctcgtcgtcatcgcaacggctcaaggcattttggtcatgcac
aaggatcgtgcccaagacgttcgtctagcggcagacgccttcaaagcgaagagctaa

DBGET integrated database retrieval system