KEGG   Halomonas beimenensis: BEI_2913Help
Entry
BEI_2913          CDS       T05125                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
hbe  Halomonas beimenensis
Pathway
hbe00030  Pentose phosphate pathway
hbe00480  Glutathione metabolism
hbe01100  Metabolic pathways
hbe01110  Biosynthesis of secondary metabolites
hbe01120  Microbial metabolism in diverse environments
hbe01130  Biosynthesis of antibiotics
hbe01200  Carbon metabolism
Module
hbe_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:hbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BEI_2913
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BEI_2913
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hbe04147]
    BEI_2913
Enzymes [BR:hbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BEI_2913
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BEI_2913
Exosome [BR:hbe04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BEI_2913
  Exosomal proteins of colorectal cancer cells
   BEI_2913
  Exosomal proteins of bladder cancer cells
   BEI_2913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ATJ83900
UniProt: A0A291PAH4
Position
complement(3083440..3084945)
Genome map
AA seq 501 aa AA seqDB search
MSQFKRPGEARSSGDIDTEIDLALFGALGDLAQRKLFPALFHLEREGLLAPDTRLLGLAR
QELDVDAFRSRIEKALKTYVKAEELDREALARFLARLDFLPLDFTKPEGYAAIREWRQEA
ARPMVVYLSVAAKIYGDICRHLEASGSLDDESRVVVEKPIGYDLASSAEINDAIGAVFPE
SRIYRIDHYLGKETVQNLIALRFANPLFGTQWNQNHISHVEITVAEKVGIEGRWGYFDDA
GQLRDMVQNHLLQLVCLIAMDPPANLDADAIRDEKVKVLKALKPFTDDMLGRDVVRGQYI
AGTIDGRSVPGYLEEEGANRASHTETFVAMKTGVANWRWAGVPFYLRTGKRMPEKLSQIV
IHFRQQPHYIFDPDQRELAANKLVIRLQPEEGIALEVLTKDSGLDKGMRLRRGPLHLDFS
SAFPKTRIPDAYERLLLEVMKGQQYLFVRRDEVEHAWRWCDSLIAAWEDDEVPRRYPAGS
WGPVASIAMITQDGRSWYEDY
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagccagttcaagcggcccggtgaggcccgatcctcaggtgacatcgacaccgaaatc
gatcttgccctgttcggggcgctcggcgatctggcccagcgaaagctgttccccgcgctc
ttccacctggagcgggaggggctgctggcccccgatacgcgcctgctcggcctggcccgc
caggagctggacgtcgacgccttccgatcccggatcgagaaggccctgaagacctacgtc
aaggccgaagagctggatcgcgaggcgctggcccgcttcctggcgcgtctcgacttcctg
cccctcgacttcaccaagcccgagggatacgccgccatccgtgagtggcgccaggaggcc
gctcgccccatggtggtctacctgtccgtggcggcgaagatctacggcgacatctgccgt
cacctggaggccagcggcagtctcgacgacgagtcgcgggtcgtggtggagaagccgatc
ggctatgacctcgcctcctccgccgagatcaatgacgccatcggcgcggtcttccccgag
tcgcgcatctatcgtatcgatcactacctgggcaaggaaaccgtccagaacctgatcgcc
ctgcgcttcgccaaccccctgttcggtacccagtggaaccagaaccacatctcccatgtg
gagatcaccgtggccgagaaggtcggcatcgagggccgctggggctacttcgacgacgcc
ggccagctccgcgacatggtccagaaccacctgctgcagctggtctgcctgatcgccatg
gacccgccggccaacctcgatgccgacgccatccgagacgagaaggtcaaggtgctcaag
gcgctcaagcccttcaccgacgacatgctgggacgcgacgtggtgcgcggccagtacatc
gccggcaccatcgacggccggtccgtgccgggttacctcgaggaggagggcgccaaccgg
gccagccacaccgagaccttcgtggccatgaagaccggggtggccaactggcgctgggcg
ggcgtgcccttctacctgcgcaccggcaagcggatgcccgagaagctctcccagatcgtc
atccacttccgtcagcagccccactacatcttcgaccccgaccagcgcgagctggccgcc
aacaagctggtgatccgcctgcagccggaggagggcatcgccctggaggtgctcaccaag
gacagcgggctggacaagggcatgcgcctgcgccgcgggcccctgcacctggacttcagc
agcgcctttcccaagacgcggatcccggatgcctacgagcgcctgttgctggaggtcatg
aagggccagcagtacctcttcgtgcggcgcgacgaggtcgagcacgcctggcgctggtgc
gacagcctgatcgccgcctgggaggacgacgaggtgccgcggcgctatcccgccggctcc
tgggggccggtcgcctccatcgccatgatcacccaggacggccgcagctggtatgaggac
tactga

DBGET integrated database retrieval system