KEGG   Helicobacter bizzozeronii: HBZC1_00380Help
Entry
HBZC1_00380       CDS       T01540                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00071  Fatty acid degradation
hbi00072  Synthesis and degradation of ketone bodies
hbi00280  Valine, leucine and isoleucine degradation
hbi00310  Lysine degradation
hbi00362  Benzoate degradation
hbi00380  Tryptophan metabolism
hbi00620  Pyruvate metabolism
hbi00630  Glyoxylate and dicarboxylate metabolism
hbi00640  Propanoate metabolism
hbi00650  Butanoate metabolism
hbi00900  Terpenoid backbone biosynthesis
hbi01100  Metabolic pathways
hbi01110  Biosynthesis of secondary metabolites
hbi01120  Microbial metabolism in diverse environments
hbi01130  Biosynthesis of antibiotics
hbi01200  Carbon metabolism
hbi01212  Fatty acid metabolism
hbi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HBZC1_00380
   00630 Glyoxylate and dicarboxylate metabolism
    HBZC1_00380
   00640 Propanoate metabolism
    HBZC1_00380
   00650 Butanoate metabolism
    HBZC1_00380
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HBZC1_00380
   00072 Synthesis and degradation of ketone bodies
    HBZC1_00380
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HBZC1_00380
   00310 Lysine degradation
    HBZC1_00380
   00380 Tryptophan metabolism
    HBZC1_00380
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HBZC1_00380
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HBZC1_00380
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HBZC1_00380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hbi04147]
    HBZC1_00380
Enzymes [BR:hbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HBZC1_00380
Exosome [BR:hbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HBZC1_00380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCB79024
UniProt: F8KQM0
Position
34308..35483
Genome map
AA seq 391 aa AA seqDB search
MHGVYIYSAKRSPIGSFNGSLSSVSATTLGSVVSAQALRTSGFDPSLVDTCIVGNVISAG
LKQAPARQVALNANLPNSVGCFLINEACGSGLRAVMLGANEIALGRSRVVLAGGIENMSL
APHLLMKSRMGFKMGDTTLEDSLFKDGLQDAYQEALMGDFAEGCAKNHNLSREEQDSFAK
HSYEKALEAIQSKAFDSEIVPISVKSKKGEVLVSVDEEPGKVDFEKGLKLKPAFDKEGTI
TAFNASKISDGASMLVIASKELAKDTSTKPLAKILDYNSFSHDPHLFPIAPAPAIKELLR
RNHKQVSDIDLYEISEAFAVVGALTQRDLGLKDSQVNVHGGAIALGHPIGASGARILTTL
VHALHRHDKHLGIACLCVGGGEAVAMLVERL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcacggagtttatatttatagtgccaagcggagccccatcgggtcgttcaatgggagt
ttatccagtgtgagtgccacgactttggggagcgtagtgagcgcgcaagccctgaggacc
agtgggtttgatccgagtttggtggatacctgcattgtgggcaatgtgatcagtgcaggg
ctcaagcaggctcccgctaggcaggtcgccctgaatgccaatctgcctaattctgtgggc
tgttttttgatcaatgaggcttgcggatcgggcttgagggcggtgatgttgggggctaat
gaaattgcgttggggcgtagccgtgtggtcttagccggaggcatagaaaatatgagtctt
gccccccacctcttgatgaaaagccgcatgggctttaaaatgggcgataccacattggag
gatagcttgtttaaagatggcttgcaagatgcttaccaagaggctttgatgggggatttt
gccgaggggtgtgctaaaaaccacaacttaagtagagaagagcaagatagctttgccaaa
cacagctatgaaaaagcccttgaggcgatccaatctaaggcttttgattctgagatcgtg
cctatcagtgtcaaaagcaaaaagggggaggtgctggtgagcgtagatgaagagccgggc
aaggtggattttgaaaagggcctaaagctcaaacccgcctttgataaagagggcacgatc
accgcctttaatgccagcaagattagcgatggggcgagcatgttggtcattgctagcaag
gagctagcaaaagacacttccactaaacccttagccaaaatcttagattacaattctttc
agccacgatccccatctcttccccattgcccccgcccctgctattaaggaacttttgaga
cgcaaccacaagcaagttagcgacattgatctatatgaaatcagcgaagctttcgctgtt
gtgggggctttgacccaaagggatttaggtttgaaagatagccaagtgaatgtgcatggg
ggggcgatcgctttggggcatcccattggggctagtggggcgcgcattctcaccactcta
gtgcatgccctacacagacatgataaacacttaggcatagcgtgtctgtgtgtgggcggg
ggtgaggcagtggcgatgttggttgagagattgtag

DBGET integrated database retrieval system