KEGG   Helicobacter bizzozeronii: HBZC1_01700Help
Entry
HBZC1_01700       CDS       T01540                                 

Definition
(GenBank) fructose-bisphosphate aldolase class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00010  Glycolysis / Gluconeogenesis
hbi00030  Pentose phosphate pathway
hbi00051  Fructose and mannose metabolism
hbi00680  Methane metabolism
hbi01100  Metabolic pathways
hbi01110  Biosynthesis of secondary metabolites
hbi01120  Microbial metabolism in diverse environments
hbi01130  Biosynthesis of antibiotics
hbi01200  Carbon metabolism
hbi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBZC1_01700
   00030 Pentose phosphate pathway
    HBZC1_01700
   00051 Fructose and mannose metabolism
    HBZC1_01700
  09102 Energy metabolism
   00680 Methane metabolism
    HBZC1_01700
Enzymes [BR:hbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HBZC1_01700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: CCB79156
UniProt: F8KQZ4
Position
complement(153544..154467)
Genome map
AA seq 307 aa AA seqDB search
MLVKGSEILNKAHQEGYGVGAFNFVNVEMLRAIFEAANQAKSPLIVQASEGAIKYLGIDM
VLGMVHTMVKRHPHIPVALHLDHGTTFESCKRAVDAGFTSVMIDASHHPYKENLELTKEV
VDYAHSKNVSVEAELGRLMGIEDNISVDEKDAVLVNPDEAEEFVKISKVDYLAPAIGTSH
GAFKFKGEPKLDFERLVEVKKRTNIPLVLHGASSIPESVSQAFLATGGDLKGSKGVPYAF
LQESIKGGINKINIDTDLRIAFIAQVRKVANEHPSEFDLRKFFTPGIEAVKEVIVERMHL
LGSANKI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctggttaaaggcagtgagattttaaacaaagcccatcaagagggctatggtgtgggc
gcatttaattttgtgaatgtggagatgttgcgcgccatttttgaggcagccaatcaggca
aaatcccctttgatcgtgcaagccagcgagggggcgattaaatatttgggcattgacatg
gtgcttggcatggtgcatacgatggtcaaacgccacccccatatccccgtggctttacat
ttggatcacgggacaacctttgagagctgtaaaagggcagtggatgcgggttttacatct
gtgatgattgatgcctcccaccacccctacaaagaaaatttggagctcactaaagaagtg
gtggattacgcccactctaaaaatgtgagcgtggaggcagaactggggcgtttgatgggg
attgaggacaatatttccgtagatgaaaaagacgcggttttagtcaatcccgatgaagct
gaagagtttgtcaaaatcagtaaggtggattatttagcccccgccattggcacaagccac
ggagcttttaaattcaagggcgaacctaagttggactttgagaggcttgtagaagttaag
aagcgcaccaatatccctctagtcttgcatggggctagctccatccctgagagcgtgagc
caagctttcttagccacaggaggggatttaaaggggagtaagggcgtgccctatgcgttt
ttacaagaatccatcaagggggggatcaataaaatcaacattgacaccgatttgcgtatc
gccttcatcgctcaggtgcgtaaagttgccaacgaacaccctagcgaatttgacttgcgt
aagtttttcaccccgggcattgaagcggtcaaagaggtcattgtggagcgcatgcaccta
ctgggtagtgccaacaaaatttag

DBGET integrated database retrieval system