KEGG   Helicobacter bizzozeronii: HBZC1_01890Help
Entry
HBZC1_01890       CDS       T01540                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00010  Glycolysis / Gluconeogenesis
hbi00051  Fructose and mannose metabolism
hbi01100  Metabolic pathways
hbi01110  Biosynthesis of secondary metabolites
hbi01120  Microbial metabolism in diverse environments
hbi01130  Biosynthesis of antibiotics
hbi01200  Carbon metabolism
hbi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBZC1_01890
   00051 Fructose and mannose metabolism
    HBZC1_01890
   00562 Inositol phosphate metabolism
    HBZC1_01890
Enzymes [BR:hbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HBZC1_01890
Exosome [BR:hbi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HBZC1_01890
  Exosomal proteins of bladder cancer cells
   HBZC1_01890
  Exosomal proteins of melanoma cells
   HBZC1_01890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Dus
Motif
Other DBs
NCBI-ProteinID: CCB79175
UniProt: F8KR09
Position
complement(170749..171474)
Genome map
AA seq 241 aa AA seqDB search
MKYVLANFKSYAIDLLPYLECLGSALDAKLAPYVTLFPPILELGQVQHAYTHFSLGAQNA
YPALDGAFTGEVTLQALQKRHIKSVLIGHSERRLLESDSFCAEKFHFFKSHHFQIIFCIG
ESLQLREQGEKALVAHLLNQLEGIDLDYPKLIVAYEPIWAIGTGVSAQSSDIASTLSALK
VALRQAGHTIPLMVYGGSVQASNATEILDLAEVDGVLVGKACLDLDSLLEIIKISAGKEL
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtatgttttggctaatttcaaatcttatgcgatcgatttgttgccctatttagag
tgcctaggtagtgctttggatgccaagctagctccctatgtaacgcttttcccccccatt
ttagaattagggcaagtccagcatgcatatacgcatttttctttgggggcacaaaatgcc
taccccgccctagatggggcattcactggcgaggttaccctgcaagccctgcaaaaaaga
cacattaaaagcgtgctcatcgggcatagtgagaggcgtttgttagagagcgattctttt
tgtgcagaaaaattccacttttttaaatcccaccatttccaaatcatcttttgcatcggc
gagtccttgcaactaagagaacaaggagaaaaggcactggtggcgcacttgttaaaccag
cttgaggggattgacctagattaccccaaactcatcgtggcttacgagcccatttgggcg
attggcacgggggtgagtgcacagagtagcgatattgccagcactttaagtgcactcaag
gtagctttacgccaagcaggacataccattcctttaatggtttatggcgggagtgtgcag
gcgagcaatgccacagagattttagatttagcagaggtagatggcgtgctggtgggtaag
gcgtgtttggatttagattccttgttagagatcattaaaattagtgctggtaaggagtta
gtatga

DBGET integrated database retrieval system