KEGG   Helicobacter bizzozeronii: HBZC1_09800Help
Entry
HBZC1_09800       CDS       T01540                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hbi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    HBZC1_09800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hbi03011]
    HBZC1_09800
Ribosome [BR:hbi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    HBZC1_09800
  Bacteria
    HBZC1_09800
  Archaea
    HBZC1_09800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF2163
Motif
Other DBs
NCBI-ProteinID: CCB79966
UniProt: F8KT25
Position
917690..918016
Genome map
AA seq 108 aa AA seqDB search
MSVALLRYTRLSPTKARLLARQVQGMNAEVAIARLEFTPNKAARILSRVISAAVYNGQYD
SKEVEVLSCRVDAGPVLKRHMPRARGRATAIRKPTAHIRVEVGKGGQK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggcgttactccgctatactagactttctccaaccaaggcgcgtttgttggct
agacaagtgcagggcatgaacgccgaagtggcgatcgcccgcctcgaattcacccccaac
aaagccgcccgcattctctctagggtgatcagcgcagcagtttataacgggcaatatgac
tctaaagaagtggaggtcttaagttgccgtgtggatgcaggtcctgttttaaaaaggcac
atgccccgcgcacgagggcgtgcaaccgccattagaaagcccaccgcacatatccgcgtt
gaagtgggcaagggggggcaaaagtaa

DBGET integrated database retrieval system