KEGG   Helicobacter bizzozeronii: HBZC1_15560Help
Entry
HBZC1_15560       CDS       T01540                                 

Definition
(GenBank) phospholipase A1 precursor
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00564  Glycerophospholipid metabolism
hbi00565  Ether lipid metabolism
hbi00592  alpha-Linolenic acid metabolism
hbi01100  Metabolic pathways
hbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HBZC1_15560
   00565 Ether lipid metabolism
    HBZC1_15560
   00590 Arachidonic acid metabolism
    HBZC1_15560
   00591 Linoleic acid metabolism
    HBZC1_15560
   00592 alpha-Linolenic acid metabolism
    HBZC1_15560
Enzymes [BR:hbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HBZC1_15560
    3.1.1.32  phospholipase A1
     HBZC1_15560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: CCB80542
UniProt: F8KP37
Position
1440671..1441759
Genome map
AA seq 362 aa AA seqDB search
MRRVFLTGCVYLCFLGGEEANNRLSPSQLAHKGYTTGPQYPDFYKPWFYGLKDSWSVPPR
KPKKVNILSDFAKKYLDIMEYRGTYFMPFYHSFTPIYQWYFPSINRYQSTEFKFQVSFRV
PVIRHFLFTTGTLYLAYTQTNWFQIYNNPQSAPMRMVNYMPELIYVYPLNIPFFTEKMGR
LSEFWIGWQHISNGIGGRQCYQPFKNGNPTDAFPGTPVHITEENKQIIVQQGGLDGGCRS
VSAGQRPVFKLTWQKGGLKIRVAYWPYIPYNQSNPNLIDFMGYGNAFIDYRRGRHHFEMR
IYDIFTQYWRYKRWHGAIRIGYTFRISRFVGLYMQYFNGYGDGLYEYDVFSNRFGVGIRL
NP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagggttttcctaacaggctgtgtttatctttgttttttagggggtgaggaggct
aataaccgcctaagcccctcgcaattagcccacaagggttatacaaccggtcctcagtac
ccagatttttacaagccatggttttatggcttaaaagactcttggagtgtgccccccaga
aagcccaaaaaagtcaatatcttaagcgactttgctaaaaaatacttggatattatggaa
taccgtgggacttactttatgcccttttaccatagctttacccccatttaccagtggtat
ttccccagcattaaccgctaccaaagcaccgaatttaaattccaagtgagttttagagtc
ccggttatccggcattttctcttcaccaccggcacactctatttagcctacacccaaacc
aactggttccaaatttataacaacccccaaagcgcgcccatgcgcatggtcaattacatg
cccgagctcatttatgtctatccgctcaatatcccctttttcaccgaaaagatggggcgt
ctgagtgagttttggattggttggcaacatatttctaatggcattgggggcaggcagtgc
taccagccttttaaaaatgggaatcccactgatgcctttccggggacacctgtgcatatc
acagaagagaataagcaaataattgtccagcaaggagggcttgatgggggttgtcgctca
gtgagtgccgggcagcgccccgtattcaaactcacatggcaaaagggggggctcaaaatt
agagtggcttactggccctatatcccttataaccaatccaacccgaatttgattgatttt
atgggttatgggaacgcttttattgactataggcgggggcggcatcattttgaaatgcgc
atttatgacattttcacgcaatattggcgctacaaacgctggcatggggcgattcgtatc
ggttataccttcagaatcagtcgctttgtcgggctttacatgcagtattttaatggctat
ggagatggactctacgaatacgatgtcttctctaaccgctttggggtcgggattcgcctc
aatccctag

DBGET integrated database retrieval system