KEGG   Helicobacter bizzozeronii: HBZC1_16060Help
Entry
HBZC1_16060       CDS       T01540                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00450  Selenocompound metabolism
hbi00970  Aminoacyl-tRNA biosynthesis
hbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    HBZC1_16060
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HBZC1_16060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hbi01007]
    HBZC1_16060
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hbi03016]
    HBZC1_16060
Enzymes [BR:hbi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     HBZC1_16060
Amino acid related enzymes [BR:hbi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   HBZC1_16060
Transfer RNA biogenesis [BR:hbi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HBZC1_16060
 Prokaryotic type
   Other AARSs
    HBZC1_16060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f zinc-ribbons_6 DUF1272
Motif
Other DBs
NCBI-ProteinID: CCB80592
UniProt: F8KP84
Position
1492532..1494421
Genome map
AA seq 629 aa AA seqDB search
MNNPKKMLVSTPIYYVNDVPHLGHAYTTFIADMLKKYHALRGKDVFLLTGTDEHGQKIAL
SAAKHHQSPLEYASTISHAFRDQWDYFNIDYNHFIRTTDLAHQQAVQKAFETMHAKGDIY
KGTYQGSYCVSCESFVASHALCPDCGKETIILEEESYFFRLSHYQERLLDFYKQHPKAIL
PLFRRNEVVRFIEQGLHDLSITRTSFEWGIKLPASLNDPKHVVYVWLDALLNYVSALGYA
STDTSKMAYFNHAIHVVGKDILRFHAIYWPAFLMSLELPLFKHLCVHGWWTIEGVKMSKS
IGNVLCAQQEAQKYGKENLRYFLLREVPLGQDGDFSSLALIRRCNADLSNTLGNLVQRLS
GMAIQYFNGELASMEVFTHYAQPYAHAQALLESLDTSMLEMQPHKYLEDLWKVFEGANVL
IAKEEPWNLIKTNKEKTMSLLVLIATLLAKGAFYLYPIMPASAQKLATLLGLSLDLPNLK
ACMQKDYVLSSLTLIKSPPLFPKLELPKEPPATPAVATPPPSKLLKIGDFSKLEIKVGTI
IQARRVPKSDKLLQLEVDFGDRTRLILSGIAKHYQPDDLIDKQVCALVNLEPRKMMGMLS
EGMILSASDAGKLKLIAPLEPMPNGSTIS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacccaaaaaaaatgttggtttctacacccatttattatgtcaatgatgtcccc
catttagggcatgcttacaccacttttatagcagatatgctcaaaaaataccacgccttg
cggggcaaagatgtttttttactcacgggcaccgatgaacacgggcaaaagatcgcctta
agtgcggctaaacaccaccaaagccccctagaatacgcctccacaatcagccacgccttt
agggatcagtgggattattttaacattgattataaccatttcatccgcaccaccgatcta
gcccaccaacaagccgtgcaaaaagcctttgagaccatgcacgccaaaggggatatttac
aagggcacatatcagggctcttattgtgtgagctgtgagagttttgtagccagccatgcg
ctctgcccagattgtggcaaagaaacgattatcttagaagaagagagttatttttttagg
ctgagtcattaccaagagcgcttgttagatttttacaaacaacaccctaaggcgatctta
cccctctttaggcgtaatgaagtggtgcgtttcatcgaacaaggcttgcacgatctctcc
atcacacggactagctttgagtgggggatcaaattacccgccagcttaaacgatcctaaa
catgtcgtgtatgtgtggctggatgctctgcttaactatgtgagcgcactaggctatgcc
agcaccgatacaagcaaaatggcgtattttaaccacgctatccatgtcgtgggcaaggat
attttacgcttccatgcgatctattggcctgcctttttgatgagcttagagctccctttg
tttaaacacctttgtgtgcatgggtggtggaccattgagggggtcaagatgagtaagagc
attgggaatgtgctgtgtgcccagcaagaggcacaaaaatacgggaaggagaacttacgc
tactttttattgcgtgaagtccccttaggtcaagatggggatttttctagccttgccttg
atccgccgctgcaatgcggacttaagcaacaccttaggtaatttagtccaacgcctaagc
ggcatggcgatccaatattttaatggggagctagccagcatggaggtctttacccactac
gcccagccctacgcccacgcccaagccctcttagagtccttagataccagcatgctagag
atgcaaccccacaaatacctagaggacttgtggaaggtctttgagggggctaatgtcttg
atcgccaaagaagagccatggaatctcattaaaactaataaagaaaaaaccatgtcttta
ctggttttgatcgccaccctcctagctaagggcgctttttatctctaccctatcatgccc
gccagtgcccaaaagctagccaccctcctagggcttagcctagatttgccaaacctcaaa
gcgtgtatgcaaaaagattatgtcctctcctctttaacactcattaaaagcccgcccctt
ttccccaaattagaactccccaaagagcccccagccaccccagcagtggctacgccaccc
ccaagcaaactcttaaaaattggggatttttccaaacttgaaatcaaggtgggcaccatt
atccaagctaggcgcgtgcctaagagtgataagctgttgcaattagaagtggattttggg
gatcgcacccgcttgattttgtcaggcattgccaagcattatcaacctgatgatctcatt
gacaaacaagtttgtgcccttgtgaatttagagcctagaaagatgatgggcatgctcagt
gaggggatgattttaagtgctagtgatgctggcaaactcaaactcatcgcccccctagag
cccatgcccaatgggagcaccattagttag

DBGET integrated database retrieval system