KEGG   Helicobacter bilis: XJ32_04350Help
Entry
XJ32_04350        CDS       T04788                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hbl  Helicobacter bilis
Pathway
hbl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hbl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    XJ32_04350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hbl03011]
    XJ32_04350
Ribosome [BR:hbl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    XJ32_04350
  Bacteria
    XJ32_04350
  Archaea
    XJ32_04350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AQQ59448
UniProt: A0A1Q2LG93
Position
complement(916247..916645)
Genome map
AA seq 132 aa AA seqDB search
MAKKQNTKQTNGGVAILRYARLSPTKARLIARQVQGMNAEVALASLEFTPNKAAKAIYKT
LASALANGGFESTGAEVTSCRVDAGPVLRRFMPRARGRATPIRKPMAHIYVEVNAVKKAA
KQTSKKSKGEVK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaacagaatacaaaacaaacaaatggtggtgtagctattttgcgttatgcg
cgtctatctcccacgaaagcgcgtttaatcgcaaggcaagtgcaaggcatgaatgctgaa
gttgcattagcaagtttagaatttactccaaacaaggcagcaaaagctatttataaaaca
ttggcatcagcacttgcaaatggtgggtttgaatctactggagctgaagttacttcgtgt
agggttgatgcaggtccggtattgcgtcgtttcatgccaagggcgagaggcagggcaact
cctatacgaaagcctatggcacatatatatgtggaagtaaatgcagtgaaaaaggcagct
aaacaaacaagcaaaaaaagtaaaggtgaggttaagtaa

DBGET integrated database retrieval system