KEGG   Helicobacter bilis: XJ32_04510Help
Entry
XJ32_04510        CDS       T04788                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hbl  Helicobacter bilis
Pathway
hbl00450  Selenocompound metabolism
hbl00970  Aminoacyl-tRNA biosynthesis
hbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XJ32_04510
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XJ32_04510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hbl01007]
    XJ32_04510
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hbl03016]
    XJ32_04510
Enzymes [BR:hbl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     XJ32_04510
Amino acid related enzymes [BR:hbl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   XJ32_04510
Transfer RNA biogenesis [BR:hbl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XJ32_04510
 Prokaryotic type
   Other AARSs
    XJ32_04510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AQQ59478
UniProt: A0A1Q2LGC5
Position
complement(944705..946696)
Genome map
AA seq 663 aa AA seqDB search
MKKLLTTPIYYVNDVPHIGHAYTTILADVMKKYWTLRGDDVFFLTGTDEHGQKIEEAAKK
HGIKTIEYANSISEKFRDTWREYDIDYDKFIRTTYFEHILSVQKAFEIMYDRGDIYKGAY
EGMYCVGCESFFTQTQVIDGIYCPDCSGKKETRLVKEESYFFALSKYQDKLLAWYRENPD
CIMPSHKRNEVIKFVEQGLQDLSITRISFEWGIKIPLKLRDSKHIIYVWLDALMNYASAL
GYGLDYNNAKEQLSYKMEQNPCLESKMEYFNNTTHIVGKDILRFHAIYWPAFLMSLDLPL
PKHILVHGWWTIDGVKMSKSIGNVIHPLDIKNAYPTDIFRYFLLREVPFGQDGDFSQIAL
INRNNGELSNDLGNLLNRLIGMSEKYFQFDLSKSYDENAYVSQKEEISRIINQSLAYMDS
MQPHKFLESVWELFYLANTMITQIAPWELIKQEKSIECKAFLNLIANILAKAALLLYPIL
PNSCKEISRALNISIDSKQFDTLIIKQGYIQDFMIQKVCALFPKIEEPRMKTMHQPFVEN
KPQKEKDSIHKPCINDTINIDYFQQIVIKVGTIIAAEKLPKSKKLLKLQVDLGEEKPRQI
IAGIAEFYDTENLIGTQACVLANLAPAKLMGEISQGMILACKDENGLSLLRTEHARVNGS
RIS
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattattaacaacgcctatttactatgtcaatgatgtgccacacattggacat
gcttatactaccattcttgctgatgttatgaaaaaatattggactcttaggggcgatgat
gtatttttccttacaggcacagatgagcatggacaaaagatagaggaagcggcaaaaaag
catgggataaaaacgattgaatatgcaaattctatcagtgaaaaattccgcgatacatgg
cgtgaatacgacatagattatgataaatttatccgcacaacttattttgagcatattcta
tccgtgcaaaaagcctttgagattatgtatgataggggggatatttataagggggcttat
gagggtatgtattgcgttggctgtgagagctttttcacgcaaacacaagtcatagatgga
atctactgccctgattgtagtggtaagaaagaaactcgccttgtcaaagaagagagttat
tttttcgccctatcaaagtatcaagacaaacttttagcatggtatagagagaatccagac
tgcattatgccttcacacaaaagaaatgaggttataaaatttgtagagcaaggcttacaa
gatttatccattactcgcataagctttgaatgggggattaagattccattaaaattgcgt
gatagtaagcatatcatttatgtatggcttgatgcgttgatgaactatgctagtgcgctt
ggctatggattagactacaataatgcgaaagagcagctaagctataaaatggagcaaaat
ccatgtttagaatctaaaatggaatactttaataacacaacgcatattgtaggtaaggat
atattgcgatttcatgcgatatattggcctgcatttcttatgagtttagatttaccactg
ccaaagcacattttagtgcatggctggtggactatcgatggtgtgaaaatgagtaaaagt
attggcaatgtaatccacccgcttgatattaaaaacgcttatcctaccgatatattccgc
tactttttattacgcgaagtgccgtttggtcaggatggcgacttctcacaaatagccctt
ataaatcgcaataatggggagttaagcaatgatttagggaatctgttaaataggcttatt
ggcatgagtgaaaaatatttccagtttgatttaagtaaaagttatgatgaaaacgcatat
gtttcacaaaaagaagagatttctcgcattattaatcaaagtttagcctatatggattct
atgcaaccgcataagtttttagagtctgtatgggaacttttctatctagcaaatactatg
attacacaaattgctccttgggaacttataaagcaagaaaaaagtatagaatgtaaagcc
tttttgaatcttattgcaaatatccttgcaaaagcagccttacttctttatccaatactg
cctaattcatgcaaagagataagcagggcattaaatatcagcatagattctaagcagttt
gatacactgataataaagcaaggatacatacaagattttatgatacaaaaagtttgtgcg
ctttttccaaagatagaagaaccacgcatgaagacaatgcaccaaccttttgtagaaaat
aaaccacaaaaagaaaaagattctatccataagccatgcataaacgatacgattaatatt
gactattttcagcaaatagtcattaaagtcggcacaattattgccgcagaaaaactccca
aaaagcaaaaaacttttaaaattgcaagttgatttaggcgaagaaaaaccgcgtcaaatc
atcgcaggtattgctgaattttatgatacagagaatctcattggcacacaagcatgtgta
ttagcaaacttagccccagcaaagcttatgggtgaaatcagtcaaggcatgattctagca
tgtaaagatgaaaatgggttaagccttttacgcacagaacatgcaagagtgaatggctca
agaatcagttaa

DBGET integrated database retrieval system