KEGG   Helicobacter bilis: XJ32_08030Help
Entry
XJ32_08030        CDS       T04788                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hbl  Helicobacter bilis
Brite
KEGG Orthology (KO) [BR:hbl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    XJ32_08030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Goodbye YrzO
Motif
Other DBs
NCBI-ProteinID: AQQ60049
UniProt: A0A1Q2LI44
Position
1761427..1763025
Genome map
AA seq 532 aa AA seqDB search
MDIQNINKIENATSFGQKDIIKIGIVLAFFIVIAGIAITFGYPVSSPVVLIFAAVVGGYM
ALNIGANDVANNVGPAVGSHAITLVGAIIIAAIAEALGAIIAGKDVVDTIKSGIINPASL
QDSKTFIYVMLAALTSGAIWLHVATALGAPVSTTHSLVGGVLGAGIMAGGFGIANWGAMG
EIALSWVVSPCLGGLIAMIFLFIIKRSITYQSDKKTAAKRVVPLLILIMSWSFSVYLVQK
TGMIKLSFGVALLAGLAIAIVIFFVSRPFIIKKADTLSNTKEDINELFTLPLIFSAALLS
FAHGANDVANAIGPLAGIYEAIRETTMEAFGGKAQVPFWIMLIGGLGISLGLALYGPKLI
KTVGSEITDLDKMRAFCVALSAAITVLIASQLGLPVSSTHIAIGAIFGVGFLREYLKKRY
YTMQQEVIEAYKGKNEEAVQRFLTKFERANIKQKQEMLQSLKENAAKTDKKNADLPVLKK
KERKSLKKAYKQELVRRSAINRIVASWLITVPLSAIFGAVTFYLISKVDIPL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggatattcaaaatattaacaagattgagaatgctacatcatttgggcaaaaggatatt
ataaagattggcattgtgcttgcattttttattgttattgctggtattgctatcactttt
ggctatcctgtcagtagccctgttgtgcttatctttgctgcggttgtgggtggctatatg
gctctcaatatcggtgcaaatgatgtggcaaataatgttggtccagcggttgggtctcat
gctatcacacttgttggtgcgataatcatcgctgcgattgcagaggctttaggggcgatt
attgctggaaaagatgtcgttgatacgattaaatctggcattattaatcccgcgagtttg
caagatagtaaaacctttatttatgtaatgcttgctgcccttacttctggggcgatttgg
ctgcatgtggctactgcgcttggtgcgcctgtatctacgacacactcacttgttggtggt
gtgcttggggctggtattatggctggtggctttggcatagcaaactggggtgctatggga
gagattgcattaagctgggttgtatcaccttgtcttggtggcttaatcgccatgatattt
ttatttatcattaagcgatctattacctatcaaagcgataaaaagactgcggcaaaacgc
gttgtgccattactaattctcattatgtcatggtcatttagcgtgtatttggtgcaaaaa
actggcatgattaaactgagttttggtgttgccttacttgctggattagccattgcaatt
gttattttctttgtttctcgtccatttatcattaaaaaggctgatacgctttcaaataca
aaagaggatattaatgagctttttacactccctttaatattttctgccgctcttcttagc
ttcgcacatggtgcaaatgatgtggcaaatgctattggacctttagcgggaatctatgag
gcaattagagagacgactatggaagcgtttggtggtaaagcacaagtgccattctggatt
atgcttattggtgggcttggaatctcgctaggactagccctttatggaccaaaacttatc
aagacggttggtagtgagattacagatcttgataaaatgcgtgctttctgtgtagccctt
tctgctgctatcaccgtgcttattgcttcacaattaggactgcctgtaagctctacacac
attgctattggtgcgatttttggcgttggatttttgcgtgaatatctaaaaaagcgttac
tacactatgcaacaagaagtaattgaggcatataaaggtaaaaatgaagaagctgtgcaa
agattcttaacaaaatttgaacgcgcaaatatcaagcaaaagcaagagatgctacaatcg
ctaaaagagaatgctgcaaaaactgataagaagaatgccgatttgcccgtattgaagaaa
aaagagcgtaaaagtctgaaaaaagcctataagcaagagctagttagacgaagtgcaatc
aatagaatcgttgcttcatggcttattaccgtgccactatcagctatctttggtgcagtt
actttttatcttatatcaaaggttgatattccgttgtag

DBGET integrated database retrieval system