KEGG   Helicobacter bilis: XJ32_10330Help
Entry
XJ32_10330        CDS       T04788                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
hbl  Helicobacter bilis
Pathway
hbl00250  Alanine, aspartate and glutamate metabolism
hbl00330  Arginine and proline metabolism
hbl01100  Metabolic pathways
hbl01110  Biosynthesis of secondary metabolites
hbl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XJ32_10330
   00330 Arginine and proline metabolism
    XJ32_10330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hbl03000]
    XJ32_10330
Enzymes [BR:hbl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     XJ32_10330
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     XJ32_10330
Transcription factors [BR:hbl03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    XJ32_10330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh
Motif
Other DBs
NCBI-ProteinID: AQQ60421
UniProt: A0A1Q2LJ46
Position
2317751..2321305
Genome map
AA seq 1184 aa AA seqDB search
MQSVDNKEIIEASLSLAKTLQHKINSDLSCKEKRFRKKMMKMLENPSSKVMLIELLDRSF
RSKDNEMAHELISHTLQKYGIADFFSSFEKVLLQLFLGMGKSMPCVSVPFFIKNLKKDTK
AMVLDASPIALKKHADKRASENIGLNVNLIGEEVLGNLESNYRLQKYEDALNSNYINYIS
IKITTIFSQINILDFEYSKREIVARLDKLYGIAEEKQKAGISKFINLDMEEFKDLELTVA
AFMESLAKFDIKAGIVLQAYLPDSYEYLKTLVAFSKARVESGKPPIKIRIVKGANMEAEE
TIASVKGWELPTFRQKVDTDSNYNKMLDYILQDSNFKYIDIGIASHNIFQIAYAMTRINR
AGAQDSFTFEMLEGMNLKASFEVASRNKLILYAPVCDDAHFNNAIAYLVRRLDENTGKDN
FMRYAFDLEIDSIAWKQQEQIFLQSIEGIKSVQETSYRQQNRLKAPFTQKANLASFFNEP
DTDFILKPNREWAEAIKTKWLNTESIEVTPIIGDKTPKDNKREIKQKGGDKVIANVYLAN
KDSLKAAMAYVKQAQNILSYEKLGEILLKTAEIVAERRNDLIGIAALEVGKTFAETDAEV
SEAIDFLRFYPHSMYKLLETHKDFMLKPKGVGVVITPWNFPVAISVGGIAASLASGNRVI
YKPSNISAVTGSILTQCFYDAGLPKDYLVFLPASGKDVNEILLKEADFAILTGGEDTAYE
ILKENPTLFLSAETGGKNATIVSKMADRDQAVKNIIHSAFSNSGQKCSATSLLILEEEVY
KDEQFKRTLIDAANSLHVGNPFDFKNKLGYLSSTIDEKVKQGLELEQGEEWVLAPSFEDE
NPYAMRPCIKYGVKEGSYSHKSEFFTPILSVICAKDLEHAIDIANSTGYGLTSGFESLDE
REWDYYLKHIEAGNLYINKSTTGAIVLRQPFGGIKKSAVGFGRKAGSYNYVAQFVDIIPN
NSTQENTDLNTNLHMGHSFIDSMQYLINITQDESIKNELKAFLQTAKSYAYFHENEFLQK
RDFVHIRGEDNLFYYVPVKSVIYRVRKEDSLSDILSVIASTQLISAKLTISLKATEMSES
LGFVLEHIKTLQLKNIAIEYQSLEQFIESAGEYELIRYLESPDNENLVYKELIGQGRAKG
KLIAYHKPYANGYFELLYYHTERAASIAFHRYGNLGRRALQGNK
NT seq 3555 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccgttgataataaagagataattgaggcaagtttgtccttagcaaagacattg
cagcacaaaatcaatagtgatttaagttgtaaagaaaaaagattccgtaaaaagatgatg
aaaatgcttgaaaatccaagcagtaaggttatgcttattgagttgcttgatagaagtttt
cgctcaaaagataatgaaatggcacacgaactcatctcgcatactttgcaaaaatatggg
attgctgattttttctcttcgtttgaaaaggtattattgcaactatttttgggtatgggt
aaaagtatgccgtgtgtgagtgtgccttttttcataaagaatctaaaaaaagatacaaaa
gctatggtgctagatgcctcgcctattgccctgaaaaaacatgcagataaaagggctagt
gaaaacattggcttaaatgtgaatctaatcggtgaagaggtgcttgggaatctagagtca
aactatcgtttgcaaaagtatgaagacgctctaaactcaaactacattaattatatctct
atcaaaattacaactattttttctcaaatcaatatcctagattttgaatactcaaagcgt
gagatagtagcaaggcttgataaactctatggcattgcagaagaaaagcaaaaggcaggt
atctcaaagtttattaatcttgatatggaagagtttaaggacttggaactcacggtggca
gcctttatggaatctcttgcgaagtttgatattaaagctgggattgtattacaagcgtat
ttaccagattcttatgagtatttaaaaactttagtagccttttctaaagcgagagtagag
agcggtaagcccccgattaagattcgcattgtaaaaggagcgaatatggaggctgaagag
actattgcaagtgtaaagggttgggagttgccgacatttagacaaaaggttgatacagat
tctaactataataaaatgcttgattatatcctgcaagattctaattttaaatacattgat
ataggtatcgcatcgcataatatctttcaaatcgcttatgcgatgacaaggataaatagg
gcaggggcgcaagatagctttacttttgaaatgcttgagggtatgaatttaaaagcaagt
tttgaggtagcttcaagaaataagcttattttatacgccccggtatgcgatgatgcgcat
tttaataatgctattgcatatcttgtaaggcgacttgatgaaaatacaggtaaagataac
tttatgcgttatgcctttgatttagagattgattctattgcgtggaaacagcaggaacaa
atctttttacaatcaatcgagggtataaaaagtgtgcaagagacaagttataggcagcaa
aatagacttaaagccccatttacacaaaaagcaaatcttgcttctttctttaacgagcct
gatactgactttatattgaaaccaaatagagaatgggcggaggcgattaagacaaagtgg
ctaaatacagaatctattgaggttacaccaataattggcgataaaactccaaaagataat
aaaagagagattaagcaaaaaggcggcgataaagtcattgctaatgtgtatttagcaaat
aaagatagtttaaaagcggctatggcgtatgtaaaacaagcacaaaatatactaagctat
gaaaagcttggcgagattttgttgaaaactgcagagattgtagcagaaaggcgtaatgat
ttaatcggtatagcagcccttgaagtgggtaaaacctttgcagaaacagacgctgaggta
agtgaggcgatagattttcttagattctatccgcatagcatgtataaattgctagaaaca
cataaagattttatgctaaagccaaagggtgttggcgtagtgattacgccgtggaatttc
cccgttgctatttctgttggtggcattgccgctagtcttgctagtgggaatagggtgatt
tataagccatctaatatttctgctgttacaggcagtatattaacgcagtgcttttatgat
gcgggactaccgaaagattatcttgtattcttacctgcaagtggcaaggatgtaaatgag
attctattaaaagaagcggattttgcgattttaacaggcggggaagatacggcttatgag
attttaaaagagaatccaacactatttttaagtgctgaaacaggcggtaaaaatgcgact
attgtaagcaaaatggcagatagagaccaagcggtaaaaaacattatccattcagctttt
tctaactctgggcagaaatgcagtgctacttctttactcatacttgaagaggaagtgtat
aaagatgagcagtttaaacgcacattgattgatgcggcaaatagccttcatgttgggaat
ccatttgactttaagaataagttagggtatctaagcagcactattgatgagaaagtaaag
cagggcttagagttagagcaaggtgaagagtgggtattagccccaagttttgaagatgaa
aatccctatgcgatgagaccatgtattaaatatggtgtaaaagagggtagctattcacat
aagagtgaatttttcacgccgattttatcagttatatgtgcgaaagatttagagcatgcc
atagatatcgcaaactctactggatatggtttaacaagcggttttgaatctcttgatgaa
agggaatgggattattatctaaagcacattgaagcagggaatctttatattaataaatct
acgacaggggcgattgtcctgcggcagccatttggtgggattaaaaagtcagcagttggc
tttggcagaaaggctggaagttataactatgtggcacaatttgtagatattatccctaat
aatagcacacaagaaaacacagatttaaacacaaatttacatatggggcatagctttatt
gatagtatgcaatatcttattaatattacgcaagatgaaagtattaaaaatgaattaaag
gcgtttttacaaactgcaaaaagctatgcgtatttccatgaaaatgagtttttacaaaaa
agggatttcgtgcatataaggggagaagacaatctcttttactatgtgccggtaaaatca
gtcatttatcgtgttagaaaagaagattctctaagtgatattttaagcgttattgctagc
actcaattaattagtgctaagcttactataagccttaaagccacagaaatgagtgaatct
ttaggttttgtgctagaacatataaaaacattgcagctaaaaaatatcgctattgagtat
caaagcctagagcagtttattgagagtgcaggggagtatgagcttatccgctatcttgaa
tcgccggataatgaaaatcttgtatataaagagctaatagggcagggcagggcgaaagga
aagttaatcgcatatcataagccctatgcgaatggatattttgagcttttatactatcat
acagagcgtgccgcaagtattgcattccatagatatgggaatcttggtagaagagcattg
caaggtaataaatag

DBGET integrated database retrieval system