KEGG   Halogeometricum borinquense: Hbor_02570Help
Entry
Hbor_02570        CDS       T01359                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00010  Glycolysis / Gluconeogenesis
hbo00030  Pentose phosphate pathway
hbo00051  Fructose and mannose metabolism
hbo00052  Galactose metabolism
hbo00230  Purine metabolism
hbo00500  Starch and sucrose metabolism
hbo00520  Amino sugar and nucleotide sugar metabolism
hbo00521  Streptomycin biosynthesis
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01120  Microbial metabolism in diverse environments
hbo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbor_02570
   00030 Pentose phosphate pathway
    Hbor_02570
   00051 Fructose and mannose metabolism
    Hbor_02570
   00052 Galactose metabolism
    Hbor_02570
   00500 Starch and sucrose metabolism
    Hbor_02570
   00520 Amino sugar and nucleotide sugar metabolism
    Hbor_02570
  Nucleotide metabolism
   00230 Purine metabolism
    Hbor_02570
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hbor_02570
Enzymes [BR:hbo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hbor_02570
    5.4.2.8  phosphomannomutase
     Hbor_02570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_IV PGM_PMM_III Smoothelin
Motif
Other DBs
NCBI-ProteinID: ADQ65867
UniProt: E4NSX9
Position
complement(238558..239922)
Genome map
AA seq 454 aa AA seqDB search
MKLFGSSGTRGVVGDGLTPEFVLRVSKAAGTVWGSDRAVVARDTRTTGEMFSNAATSGLA
SVGVDVDVLGAVPTPGVVRYCEVEEVPAVVITASHNPPEYNGIKLVGDDGVELSVADLER
IEDHVLAEEFDTAAWDEVGEIRRVDSSNRDYVDDLLASVDREAIADANLTVALDPGHGAG
CLTSPDFFRELGCEVVTVNANPDGHFPGRESEPVGSKLGDLCRLVKASDADVGIAHDGDA
DRAVFVDENGEFVAGEASLAALAAAQLEEDDTAVAAVNVSQRLVDVCNEVGANLELTPIG
ATNLITRIRDLWAQGETVPIAGEGNGGIFFPNYRLVRDGAYTAAKFLELITDREVSDVVA
PYTDYVNVRVNLGYDDEAELEAMLDAAREYAESADATPNTTDGYRLDYGDAWVLVRPSGT
EPKVRVYAEARDEARAEDLAAGAKDALLAALEDV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttcggttcgagcgggacccgtggcgtggtgggagatggtctcacgcccgag
ttcgtcctgcgcgtctcgaaggcggccgggacggtctgggggtcggaccgtgcggtggtc
gcacgagacactcgaacgacgggagagatgttctcgaacgccgcaaccagcggactggcg
agtgtcggcgtagacgtggacgtgctcggtgctgtccccacgcccggggtcgtccgctac
tgcgaagtcgaggaggtgcccgcagtagtcatcacggcctcgcacaacccgccggagtac
aacggcatcaaactcgtcggcgacgacggcgtcgaactctccgtcgccgacttagagcga
atcgaggaccacgtgctcgccgaggagttcgacaccgcggcgtgggacgaagtcggtgag
attcgccgggtcgattcctcgaaccgcgactacgtggacgacctgctcgcgtccgttgac
cgcgaagccatcgccgacgcgaacttgacggtcgccctcgaccccggccacggtgctggc
tgtctcactagtcccgacttcttccgcgaactcggctgtgaggtcgtgacggtcaacgcc
aacccggacggtcacttccccggccgcgaatccgaaccggtcggcagcaaactcggcgac
ctctgccgactcgtgaaagcaagcgacgcagatgttggtatcgcccacgacggcgacgcc
gacagagccgtcttcgtggacgagaacggcgagttcgtcgccggtgaagcatcgcttgcc
gccctcgccgccgcacaacttgaggaagacgacaccgccgtcgccgccgtgaacgtctca
caacgactcgtggacgtgtgcaacgaagtcggcgcgaatctcgaactgacacctatcggc
gcgacgaacctcatcacccgcatccgcgacctgtgggcgcagggggaaactgtccccatc
gcgggcgagggcaacggggggattttcttcccgaactaccgcctcgtgcgcgacggcgcg
tacacggccgcgaagttcctcgaactcatcaccgaccgcgaggtgagcgatgttgtcgct
ccgtacacggactacgtgaacgtccgcgtcaacctcggatacgacgacgaggcggaactc
gaagcgatgcttgacgccgctcgcgagtacgccgaatccgccgacgcgaccccgaacacc
accgacggctatcgcctcgattacggcgatgcgtgggttctcgtccgcccgtccggcacc
gaaccgaaagtccgcgtctacgctgaagcccgcgacgaagcccgcgcagaagaccttgcc
gccggggccaaggacgcgctgctggccgctctcgaagacgtctaa

DBGET integrated database retrieval system