KEGG   Halogeometricum borinquense: Hbor_07270Help
Entry
Hbor_07270        CDS       T01359                                 

Definition
(GenBank) siroheme synthase, N-terminal domain
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00860  Porphyrin and chlorophyll metabolism
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01120  Microbial metabolism in diverse environments
Module
hbo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hbo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hbor_07270
Enzymes [BR:hbo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     Hbor_07270
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     Hbor_07270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M CysG_dimeriser PcrB
Motif
Other DBs
NCBI-ProteinID: ADQ66325
UniProt: E4NNH1
Position
complement(674797..675459)
Genome map
AA seq 220 aa AA seqDB search
MIPLYHDFTDESVLVFGGGPVGARKARRFAAEANVIVVSPRFEEDDYGDAECVRAEPTPD
DVSDWVSRVEPALVVAATPDGGVNDAAERAAQETGALVNRADESAAAGDGDRAARSAVVP
ATIEDGDVRVAISTGGASPALAKYLRERIESEIDGAGAMAELTGQLRQELRETDYTPDER
RAAVRAVVQSPKVWKALRTGESKARQEADRVIRNTVGGER
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgataccgctgtaccacgacttcacggatgagtccgtcctcgtcttcggcggcggcccc
gtcggcgcgcggaaagcccgtcgcttcgccgccgaggcgaacgtaatcgtcgtcagtccg
aggttcgaggaggacgactacggcgacgccgagtgtgttcgggccgaaccgacgcccgac
gacgtcagtgactgggtatcgcgggtcgaaccggcgttagtcgtcgcggcaacacctgac
ggcggggtgaacgacgccgccgaacgcgccgcacaggagacgggtgcactcgtgaaccgc
gccgacgagagcgccgccgcaggagacggcgaccgagcagcgagaagcgccgtcgttccg
gcaaccatcgaggacggcgacgtgcgcgtggcgatatcgacgggcggggcgagtccagcg
ctggcgaagtacctgcgcgagcggatcgagtcagaaatcgacggtgcaggcgcgatggcg
gagttgacgggacaactccgtcaagaactccgcgagaccgactatacgcccgatgaacga
cgggcggcggtccgcgccgtagtacagtccccgaaggtttggaaggctttacgtacaggg
gaatctaaagcccgccaagaggcagaccgcgtgatacggaacacagtcggaggtgaaaga
tga

DBGET integrated database retrieval system