KEGG   Halogeometricum borinquense: Hbor_16510Help
Entry
Hbor_16510        CDS       T01359                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00220  Arginine biosynthesis
hbo00330  Arginine and proline metabolism
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01130  Biosynthesis of antibiotics
hbo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Hbor_16510
   00330 Arginine and proline metabolism
    Hbor_16510
Enzymes [BR:hbo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Hbor_16510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADQ67219
UniProt: E4NLL6
Position
1573971..1574870
Genome map
AA seq 299 aa AA seqDB search
MNQHTRIIGVPTDYGANRRGVDMGPSALRYAGLVDELSSAGVSTEDAGDLAVPHHAIHDA
DAGGENAKHINEVEEVTTALADAVADALSDEVTPLVLGGDHSIAIGSMVGSARDADIGVV
WFDAHGDFNTPETSPSGNVHGMPLAAALGIGDFEGVEWANAPRLKEENVAIVGLRDVDEN
ETTAIQDSDVTAYTMSDIDERGITEVTQDALDVATNGTDGVHVSLDLDWLDPREAPGVGT
PVRGGVTYREAHAAMELVAESGAMRSLELVEVNPILDEHNETAAVATELAASGFGKRIL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcacactcggattatcggtgttccgaccgactacggtgcgaaccgacgtggt
gtcgacatgggcccctccgcacttcgatatgcgggtctcgtcgatgaactctcgtcagcg
ggcgtttcgacggaagacgccggtgatctcgcggtcccacaccatgcgattcacgacgcc
gacgctggtggcgaaaacgcaaagcacatcaacgaagtcgaggaggtcacaacggccctc
gccgacgccgtcgccgatgcgctttcggatgaggttacgccgctcgttctcggcggcgac
cactctatcgccatcgggtcgatggtcggaagcgcccgcgacgccgatatcggcgtcgtc
tggttcgacgctcacggcgacttcaacacgcccgaaacctcgccatcggggaacgttcac
ggcatgcctcttgccgccgcgctcggcatcggtgacttcgagggcgtcgagtgggccaac
gccccgcgcctgaaagaagaaaacgtcgccatcgtcggcctccgcgacgtcgacgaaaac
gagaccacggcgattcaggacagcgacgtgaccgcctacacgatgtccgatatcgacgag
cgcggcatcaccgaagtgacgcaggacgctctcgatgtcgccacgaacggcaccgacggc
gttcacgtcagtctcgacctcgactggctcgaccccagagaggcacccggcgtcgggacg
cccgtccgcggcggtgtaacctaccgcgaggcgcacgcggcgatggaactcgtcgccgag
tcgggcgcgatgcgctcgctcgaacttgtcgaggtcaacccgatccttgatgaacacaac
gagacggccgcagtagcgaccgaactcgccgcaagcggtttcggaaagcgaattctctag

DBGET integrated database retrieval system