KEGG   Halogeometricum borinquense: Hbor_22720Help
Entry
Hbor_22720        CDS       T01359                                 

Definition
(GenBank) glucose 1-dehydrogenase
  KO
K22969  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00030  Pentose phosphate pathway
hbo01100  Metabolic pathways
hbo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hbor_22720
Enzymes [BR:hbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Hbor_22720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_dehyd_C ADH_N ADH_zinc_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ADQ67833
UniProt: E4NQG0
Position
complement(2169938..2171017)
Genome map
AA seq 359 aa AA seqDB search
MRAIAVKKGERRPVLVDKPRPEPETGEALVRTLRVGVDGTDHEVISGGHGGFPDGEDHLV
LGHEAVGVVEDPNGTRFEAGDVVVPTVRRPPNGGNEYFERGEPDMAPEGMYHERGIVGEH
GFMAEYFVSHEQYLVQIPESLTDLGFLIEPISITEKAVELAYASRSSFTWEPESAIVLGN
GSLGLLTLALLRDKLGYDRLYCLGRRDRPDPTIDIIEKLGATYVDSRETPVSAVPDEFES
MDLVYEATGYAKHAFDSVRALAPNGVATLLGVPGSWEFEIDGGEIHKEIVLHNKALLGSV
NSHVKHFESAVDTLAAYPEWFTDDLVTSVCDLDNFAAAFEDDDTTIKTAVQFSTYEERR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaatcgcagtgaagaagggcgagagacgacccgtcctcgtggacaagccacgt
ccggaaccggagacgggcgaagcgctcgtccggaccctccgcgtcggcgtggacgggacc
gaccacgaggttatttccgggggtcacgggggattcccggacggggaggatcacctcgtc
ctcggccacgaagccgtcggcgtcgtcgaagacccgaacggcacccgattcgaggcaggc
gacgtggtcgtcccgacggtccgacggccgcccaacggcgggaacgagtacttcgaacgc
ggcgaacccgatatggcccccgagggaatgtaccacgaacgggggatcgtcggcgaacac
ggcttcatggccgagtatttcgtcagccacgagcagtatctcgtccagattcccgagtcg
ctgaccgacctcggctttctcatcgaaccgatctcgatcaccgagaaggcagtcgaactc
gcgtacgcctcccggtcgagtttcacgtgggaacctgagtcggcaatcgttctcgggaac
gggagcctcggtctcctcacgctggcgctcctgcgagacaaactcggctacgaccgcctg
tactgtctcgggcggcgcgaccgtccggacccgactatcgacattatcgagaaactcggg
gcgacgtacgtagactcccgagagacgcccgtctcggccgtccccgacgagttcgaatcg
atggatctcgtctacgaggcgacggggtacgctaagcacgccttcgacagcgtccgcgcg
ctcgcaccgaacggtgtcgccacgctcctcggcgtccccggttcgtgggagttcgaaatc
gacggcggcgagatacacaaagagatcgtcctgcacaacaaggcgttgcttggaagcgtc
aactcacacgtcaaacacttcgaatccgcagtcgatacgctcgcggcgtatccggagtgg
tttacggacgatctcgtcacgagcgtgtgtgaccttgacaatttcgcggcggcattcgaa
gacgacgacaccactataaaaaccgccgttcaattcagcacgtatgaagaacgtcgatga

DBGET integrated database retrieval system