KEGG   Halogeometricum borinquense: Hbor_23990Help
Entry
Hbor_23990        CDS       T01359                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00260  Glycine, serine and threonine metabolism
hbo00750  Vitamin B6 metabolism
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01120  Microbial metabolism in diverse environments
hbo01230  Biosynthesis of amino acids
Module
hbo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbor_23990
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hbor_23990
Enzymes [BR:hbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hbor_23990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADQ67958
UniProt: E4NRB7
Position
complement(2297248..2298423)
Genome map
AA seq 391 aa AA seqDB search
METREAFLGLKCAETGERYDASTTGESDAGVHLTPVYDLDAVDWADGGLADRPTDTMWRY
ADLLPFSSPLTANEGGTPLVASAELAAELGIKSLSIKDEGRNPTGTVLDRGLSPAVTAAR
EADAELVALASAGNAGQSAASYASMADLRSYAFVPSRAPFSNKAMVNVHGGEMRVVGGRY
PDAEDGLHEQLQSDWFTLQEFDNPYRHDGIKTLAFEVAESLDWSVPDAVIVPTSTGEVVT
GVANGFRQLRELGLIDEPPSIYAAQASGCAPIYAAHERGERDVEPWEHPDTIVGELEIPD
PKGGAAAVHAVEQTDGDILAIDDEDILESAVVAAQTAGVEVGTAGGAAMAAAWQLAEDGV
VGETDDVVVVNTESGTKTADILRSHLMGQGI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggagacacgcgaggcgttcctcggattgaagtgcgccgagacgggcgagcgatacgac
gcgagtacgacgggcgaaagcgacgccggtgtgcatttgactccggtctacgacctcgac
gccgtagactgggccgacggcggactcgccgaccgcccgacggacacgatgtggcgctat
gccgacctcctgcccttctcttcgcctctcacggcgaacgagggtgggacgccactcgta
gcatccgccgaactcgccgccgaactcggcatcaagtcgctctcgatcaaagacgagggc
cggaatccgaccgggacggtcctcgacagagggctctcgcctgccgtcacggccgcacgc
gaagcggatgcggaactggtcgccctcgcctcggcgggtaacgcgggccagtcggcggcg
tcgtacgccagcatggccgaccttcggtcgtatgcgttcgtcccctcgcgcgcgccgttc
tcgaacaaggcgatggtgaacgtccacggcggcgagatgcgcgtcgtcggcggccggtac
cctgacgccgaggacggactccacgagcaactgcagtctgattggttcaccctgcaggag
ttcgacaacccctaccgccacgacggtatcaagacgctcgcgttcgaggtggctgagtca
ctcgactggtccgtcccggacgctgtcatcgttccgacgagtacgggtgaagtcgtcact
ggcgtcgcaaacggcttccgccaactccgcgaactcggccttatagacgagcctccatcg
atctacgcggcccaagcgtccggctgcgcgccgatatacgccgctcacgaacgcggcgaa
cgcgacgtagaaccgtgggaacaccccgacactatcgtcggcgaactggagattcccgat
ccgaaaggtggggccgcggccgtccacgccgttgaacaaacggacggtgacatcctcgca
atcgacgatgaagacattctcgagagcgccgtcgtcgccgcacagaccgccggcgtcgaa
gtcggcactgccggtggtgcggcgatggccgccgcgtggcaactcgcagaagacggcgtc
gtgggcgaaaccgacgatgtcgtcgtcgtgaacactgaatccggtacgaagacggcagat
attctcagaagccacctgatgggacagggtatctaa

DBGET integrated database retrieval system