KEGG   Halogeometricum borinquense: Hbor_27020Help
Entry
Hbor_27020        CDS       T01359                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00010  Glycolysis / Gluconeogenesis
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01120  Microbial metabolism in diverse environments
hbo01130  Biosynthesis of antibiotics
hbo01200  Carbon metabolism
hbo01230  Biosynthesis of amino acids
Module
hbo_M00002  Glycolysis, core module involving three-carbon compounds
hbo_M00308  Semi-phosphorylative Entner-Doudoroff pathway, gluconate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbor_27020
Enzymes [BR:hbo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Hbor_27020
Membrane trafficking [BR:hbo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Hbor_27020
Exosome [BR:hbo04147]
 Exosomal proteins
  Proteins found in most exosomes
   Hbor_27020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N
Motif
Other DBs
NCBI-ProteinID: ADQ68249
UniProt: E4NTU4
Position
complement(2588071..2589087)
Genome map
AA seq 338 aa AA seqDB search
MGDDDVVRVGLNGFGRIGRNVFRAVMENPKVELVGINDVMDFEDMAYLAKYDTVMGRQDE
VSLDGDELVAGDTSVPLFNIQSPAELPWDELNVDVALECTGIFRTKQDASAHLDAGAHKV
LISAPPKGEEPVKQIVYGVNHDEYDGEDVVSNASCTTNSVTPVAKVLDEEFGIESGLLTT
VHAYTGSQNLIDGPKAKKRRGRAAAENIVPTSTGAAQAATEILPQLDGKLDGMAMRVPVP
NGSITELVVSLDETPSVEELNDAFRDAADSGPLAGVLGYTDDEVVSSDIVGLPFSSTVDL
QSTNMVNDGGLYKILTWYDNEYGFSNRMLDMAHFITHG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgacgacgacgtagttcgcgtcggcctgaacgggttcggtcggatcgggcggaac
gtgttccgcgcggtgatggagaatccgaaggtggaactcgtcggcatcaacgacgtgatg
gacttcgaggacatggcctatctcgccaagtacgatacggtgatgggccggcaggatgag
gtctctctcgacggcgacgaactcgtcgcgggcgacacgtccgtcccgcttttcaacatc
cagagtcccgccgaactgccgtgggacgaactcaacgtggacgttgcgctcgaatgtacg
ggcattttccgcaccaagcaggacgcttccgcacacctcgatgcgggcgcacataaggtt
ctcatctccgcaccgccgaagggcgaggaaccggtcaaacagatagtctacggcgtcaat
cacgacgagtacgacggcgaggacgtagtctcgaacgcctcgtgtacgacgaactccgtc
acgcccgtggcgaaagtcctcgacgaagagttcggcatcgagtccggtctgttgacgacg
gtccacgcctacaccggatcgcagaacctcatcgacggcccgaaggccaagaagcgccgc
ggccgcgccgccgccgagaatatcgtcccaacctcgacgggtgccgcacaggccgcgacc
gagattctgccgcaactggacggcaaactcgacggaatggcgatgcgcgtccccgtcccc
aacggttcgatcacggaactcgtcgtctcactggacgagacaccgtcggtcgaagaacta
aacgacgccttccgtgacgctgctgactccggtccgctcgcgggcgtcctcgggtacact
gacgacgaagtcgtctcctcggatatcgtcggtctgccgttctcctcgacggttgatctt
cagtctacgaacatggtcaacgacggcggtctctacaagatcctgacgtggtacgacaac
gagtatggcttctcgaaccggatgctcgatatggcccacttcatcacccacggctga

DBGET integrated database retrieval system