KEGG   Halogeometricum borinquense: Hbor_27880Help
Entry
Hbor_27880        CDS       T01359                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00010  Glycolysis / Gluconeogenesis
hbo00052  Galactose metabolism
hbo00500  Starch and sucrose metabolism
hbo00520  Amino sugar and nucleotide sugar metabolism
hbo00521  Streptomycin biosynthesis
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01120  Microbial metabolism in diverse environments
hbo01130  Biosynthesis of antibiotics
hbo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbor_27880
   00052 Galactose metabolism
    Hbor_27880
   00500 Starch and sucrose metabolism
    Hbor_27880
   00520 Amino sugar and nucleotide sugar metabolism
    Hbor_27880
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hbor_27880
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Hbor_27880
Enzymes [BR:hbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Hbor_27880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: ADQ68332
UniProt: E4NL83
Position
complement(2659614..2660582)
Genome map
AA seq 322 aa AA seqDB search
MAYYVGVDLGATNIRAVVADEDGTVIASRSDGTPRGPTGIAVTEAILRVVRETCSEAGIR
PNQAVAAGVASIGPLDLAEGAVENPANLPDTIDRIPLTGPLSVLLDTERVYLHNDTNAGV
IGERFHSERNPDDMVYVTISSGVGAGVCVDGNVLSGWDGNAGEVGHMTLDPQGLLTCGCG
HDGHWEAYCSGNNIPRYAEFLYEEDDVETSLPIDDPDFSAADVFNHAEDDEFARYVVDQV
GHWNAMGIANIVHAYAPLTIYVGGAVALNNPDLTLDPIRERMDEMVMVNVPQIELTTLGD
EVVVQGALASAMTGGTGDRSRL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcctactacgtgggtgtcgacctcggggcgactaacatccgcgcggtcgtagccgac
gaagacggaactgtcatcgccagccgtagcgatggaacgcctcgtggtccgacgggaatt
gcggtgacggaagcgattcttcgtgtcgtccgcgagacgtgttcggaagcgggcatcaga
cccaaccaagccgtcgccgcaggcgtcgcttccatcggtccgctggacttggccgaaggt
gccgtcgaaaacccggcgaacctccccgatacaatcgaccgcatcccgcttacgggaccg
ctgtcagttctcctcgacaccgaacgtgtctaccttcataacgacacgaacgcaggcgtc
atcggcgaacgattccactcggaacggaaccccgacgacatggtctacgtcaccatctcg
tcgggtgtcggcgcgggcgtctgcgtcgatggtaacgtcctctccggatgggacggtaac
gcgggcgaagtcgggcatatgacgctcgacccgcagggactcctcacctgcggttgtgga
cacgacggacactgggaggcgtactgttcgggcaacaatatcccgcgctacgccgaattt
ctctacgaggaagacgacgtggaaacgtcgcttccgattgacgatcccgacttttctgcg
gccgacgtgttcaaccacgccgaagacgacgagttcgcccgttacgtcgtcgatcaggtc
ggccactggaacgcgatgggcatcgccaatatcgtccacgcgtacgccccactcacaatc
tacgtcggcggtgccgtcgccctcaacaatccagacctcactttggacccgatccgcgaa
cggatggacgagatggtgatggtgaacgtcccacagatcgagttgacgacgctgggtgac
gaagtcgtggtgcagggagcgttagcgagtgcgatgaccggcgggaccggcgaccggtct
cgtctgtag

DBGET integrated database retrieval system