KEGG   Hevea brasiliensis (rubber tree): 110631965Help
Entry
110631965         CDS       T05150                                 

Definition
(RefSeq) palmitoyl-acyl carrier protein thioesterase, chloroplastic-like
  KO
K10781  fatty acyl-ACP thioesterase B [EC:3.1.2.14 3.1.2.21]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00061  Fatty acid biosynthesis
hbr01100  Metabolic pathways
hbr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    110631965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hbr01004]
    110631965
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.14  oleoyl-[acyl-carrier-protein] hydrolase
     110631965
    3.1.2.21  dodecanoyl-[acyl-carrier-protein] hydrolase
     110631965
Lipid biosynthesis proteins [BR:hbr01004]
 Fatty acid synthase
  Component type
   110631965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-ACP_TE
Motif
Other DBs
NCBI-GeneID: 110631965
NCBI-ProteinID: XP_021635712
Position
Unknown
AA seq 371 aa AA seqDB search
MAATGSGFLLVNKHVQVQAFQKKKINQMKKFVNDEMLMASPSSRKKIISQEYGVWKKHFA
CVSATTTAKTQKFNSWKSNSTVASGGSGRLVQDGLVYRQSFLVRSFEIGFDRKLSLSALT
NYLQDTAIDQCRVIGASADGFGSTPEMIRQDLIWVASTLQIVVDSYPSWLDVVQVDTWFY
PSGQNSLSRDWIVRDGKTGNTLAHATSLWVLMNKKTRKLSKLKKEIKEELAPHFRNCDPI
ITKDSRKLLQLDVSTADYARTGLTPGWDQLDLNQHVNHVQYINWILENVPRSFVEHHKLS
AITLEYRRECTTDSVLQSLAKIVKNGICHNNSNNVIELEHLLLLENGSEIAKGRTIWKPR
EIPVENASQHK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaactggtagtggattcttgctagttaacaagcacgtccaagtccaggccttt
caaaagaaaaaaatcaaccaaatgaaaaaattcgtcaatgatgagatgcttatggcttca
ccatcttctagaaagaagattatttcccaagaatatggtgtttggaagaagcattttgct
tgtgtcagtgcgaccactactgcgaaaacgcagaaatttaattcttggaaatcaaacagt
actgttgccagtggtggaagtggaagattggtgcaagatggcctcgtttacaggcaaagc
tttttggttagatcatttgaaataggctttgacagaaaactatccttgtctgccttgacc
aattatttacaggacactgcaattgaccagtgtagagttatcggggcatcggcagatggt
tttggttcaacaccagaaatgattagacaggatttgatatgggtagcctccactttgcag
atagtagtggatagctatccttcctggcttgatgttgttcaagtagacacttggttttat
ccatcaggacaaaatagtttaagccgtgactggattgttcgtgatggtaagacaggaaat
actttggctcacgcaaccagtctatgggtgttgatgaataagaaaacaaggaaattatcc
aagcttaaaaaggaaatcaaagaagagttagctcctcattttaggaattgtgatcctatc
attactaaggatagcagaaaattgctgcaactcgatgttagtacagcagattatgctcgt
acaggtttaacacctggttgggatcagcttgatctcaatcagcacgtgaaccatgttcaa
tacattaactggattcttgagaatgttccccgctctttcgtagaacatcacaagctttct
gccataactttggagtaccggagagagtgcaccacagacagcgtactgcagtctctagct
aaaattgttaaaaacggcatctgtcataataatagtaataatgtgatagagttggagcat
ttgcttctcttggagaatggctccgaaattgctaagggaaggaccatttggaagccaaga
gagattccagtagaaaatgctagccagcataagtaa

DBGET integrated database retrieval system