KEGG   Hevea brasiliensis (rubber tree): 110633332Help
Entry
110633332         CDS       T05150                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110633332
Enzymes [BR:hbr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     110633332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 110633332
NCBI-ProteinID: XP_021637583
Position
Unknown
AA seq 172 aa AA seqDB search
MANPKVFFDMSVGGHPAGKIVMELYADVVPRTAENFRALCTGEKGIGKSGKPLHYKGSSF
HRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFTKKHTGPGVLSMANAGPGTNGSQFF
VCTAKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSSSGRTSKPVVIADCGQLS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccctaaggtcttcttcgacatgtccgttggcggtcacccagccggcaagatc
gtgatggagctctacgccgacgtcgttcctcgtacggctgagaatttccgcgctctctgc
accggagagaagggaattggcaagagcggaaagcctctgcactacaagggatcctccttc
caccgcgtgattccaggctttatgtgccagggaggcgacttcactgctggaaatggcacc
ggcggtgagtcgatctacggagcgaaatttgctgatgagaacttcacgaagaagcatact
ggtcccggtgtgctttccatggctaatgctggtcccggaaccaacggatctcagttcttc
gtctgtactgccaagactgagtggcttgatggaaagcacgtggtcttcggtcaagttgtg
gagggtatggatgtggtgaaggccatagaaaaggtggggtccagctccggaaggacctcc
aagcctgttgtgatcgccgattgtggtcagctttcttaa

DBGET integrated database retrieval system