KEGG   Hevea brasiliensis (rubber tree): 110634286Help
Entry
110634286         CDS       T05150                                 

Definition
(RefSeq) polyamine oxidase 1-like
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00330  Arginine and proline metabolism
hbr00410  beta-Alanine metabolism
hbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    110634286
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110634286
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     110634286
    1.5.3.16  spermine oxidase
     110634286
    1.5.3.-  
     110634286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_3 Pyr_redox_2 Thi4 FAD_binding_3 GIDA FAD_binding_2 HI0933_like FMO-like Pyr_redox AlaDh_PNT_C Shikimate_DH FAD_oxidored Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 110634286
NCBI-ProteinID: XP_021638922
Position
Unknown
AA seq 497 aa AA seqDB search
MDFPSRSSVIIIGAGISGLSAAKVLAENGIEDLVILEASDRIGGRIRKENFGGVSVELGA
GWIAGVGGKESNPVWELANQSGLRTCFSDYSNARYNIYDRSGKIFPSGVAADSYKKAVDS
AIMKLRSLEANHVDVGEVIEPPGSPKTPIELAIDFILHDFEMAVFAIEPISTYVDFGERE
FLVADERGYEYLLYKMAEDFLFTSEDKILDARLKLNKVVREIQHSRNGVIVKTEDGSVYE
ANYVILSVSIGVLQSDLISFRPPLPRWKTEAIGKCDVMVYTKIFFKFPYKFWPCGPEKEF
FIYAHERRGYYTFWQHMENAYPGSNVLVVTLTNGESKRVETQSDEETLKEAMQVLRDMFG
PNIPNATGILVPRWWNNRFQRGSYSNYPIISNNHVLQDIKAPVGHIFFTGEHTSERFNGY
VHGGYLSGIDTSKSLLEEMREEKERKCESQAFLLEPLLALTGSLTLTQTETVSNLHKCDI
PTQLYLSGKLGIPEAIL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggactttccttctcgctcctccgtcatcatcattggcgctggcatctccggtttatct
gcggcgaaggtgttggcggagaatggaatagaggacctggtgattttagaagcgtccgat
cgtattggcggtaggatccgtaaggaaaatttcggtggtgtctcggtggagctcggtgct
ggttggatcgccggtgttggtggtaaagagtccaatccggtttgggagctcgcaaatcaa
tctggtctccgtacttgcttctctgactatagtaatgctcgttataatatctacgatcgc
agcggaaagatatttccaagtggggtggcggcggattcctacaagaaggcggtggattca
gctattatgaagctgaggagcctggaggcaaaccatgttgatgttggtgaagttattgaa
ccacctggctcacccaagacaccaatagagctcgccattgacttcattctccatgacttt
gagatggcagtatttgctatagagccaatatcaacatatgttgattttggagaaagagaa
tttctagtagcagatgaaagagggtacgagtatttgctatacaaaatggccgaggatttt
ctatttacctctgaggataaaatcttggacgctcgtttgaaactcaacaaggttgtgagg
gaaatacagcactcgagaaacggtgttattgtgaaaacggaggatggatccgtctacgaa
gctaattacgtgattttgtcagttagcattggtgttctccagagcgaccttatttctttt
aggcctcccttgcccaggtggaaaacagaggccattgggaaatgtgatgtaatggtatac
acgaagattttcttcaagtttccatataaattttggccatgtggtcctgaaaaagaattc
tttatctatgcccacgagcggagaggatactacacgttttggcagcacatggagaatgca
taccctggttcaaatgtcctggttgtaacgttgaccaatggggaatcgaaacgtgtcgag
actcaatctgacgaggagacattgaaagaagccatgcaagtgcttagagacatgtttggg
cccaacatacccaacgccactggtattcttgtgccccgctggtggaacaacagattccag
cgtggcagctacagcaattaccccatcatttctaataaccacgttcttcaagatattaag
gccccagtaggccacattttttttactggtgaacatactagtgaaagatttaatggttat
gtgcatggtggatatctttcaggtattgatacaagtaaatctctattggaagaaatgaga
gaagaaaaggaaagaaaatgtgagagtcaagcatttttgctagagcccttgctagcattg
acaggatcattaacacttacacaaacagaaacagtttcaaatctacacaaatgtgatatt
cccacacaactatatcttagtggcaagcttggcattcccgaggcgatattatga

DBGET integrated database retrieval system