KEGG   Hevea brasiliensis (rubber tree): 110635230Help
Entry
110635230         CDS       T05150                                 

Definition
(RefSeq) uncharacterized protein LOC110635230
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00790  Folate biosynthesis
hbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110635230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hbr04147]
    110635230
Enzymes [BR:hbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     110635230
Exosome [BR:hbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110635230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 110635230
NCBI-ProteinID: XP_021640170
Position
Unknown
AA seq 208 aa AA seqDB search
MATISLSFRFPPLPKLSPPLHHRVDFSVLTWTRIATLRTCATGGDLLGDFGARDPFPAEL
ESGFAEKVVGNVDTEHKILIPNISALSLSQQECTPISPLLDPMSKDDAQKLLKKVFGWRL
LDEEDGLKLQCLWKLRDFKCGVELINRIYKVTESSGHFPNLHLEQTNQVRAELWTSSIGG
LSMNDFIVAAKIDEIKTSDLAPRKRIWA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggctaccatcagtctctccttccgttttccacctcttcctaaattgtctcctccactc
caccaccgggttgacttttccgtcttgacttggactagaatcgctaccttgagaacttgt
gctacgggaggggacttgctgggtgattttggggccagagaccctttccctgcagagtta
gagagtggatttgcggagaaagtggtaggcaatgttgatactgagcataagattcttatt
cccaatatctctgctctgtctctttcccagcaagagtgcacccctatatctcccttactg
gatcccatgtctaaggatgatgcccaaaagctcttgaagaaggtttttggctggagactc
ctggatgaagaagatgggcttaaactgcaatgcttgtggaaattgagagattttaaatgt
ggggttgaacttatcaatagaatttacaaggttacagaatcttctgggcattttccgaat
ctgcatttggaacagaccaaccaagttagagctgaactatggacttcctccattggaggc
ctgagtatgaatgatttcattgtagctgccaaaattgatgagattaagacatcagatctt
gcccctagaaaaagaatatgggcataa

DBGET integrated database retrieval system