KEGG   Hevea brasiliensis (rubber tree): 110636146Help
Entry
110636146         CDS       T05150                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr03040  Spliceosome
hbr04141  Protein processing in endoplasmic reticulum
hbr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110636146
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110636146
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110636146
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hbr01009]
    110636146
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hbr03041]
    110636146
   03009 Ribosome biogenesis [BR:hbr03009]
    110636146
   03110 Chaperones and folding catalysts [BR:hbr03110]
    110636146
   04131 Membrane trafficking [BR:hbr04131]
    110636146
   03051 Proteasome [BR:hbr03051]
    110636146
   03029 Mitochondrial biogenesis [BR:hbr03029]
    110636146
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hbr04147]
    110636146
Protein phosphatases and associated proteins [BR:hbr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110636146
Spliceosome [BR:hbr03041]
 Complex B
  Other components
   Prp19 complex
    110636146
 Complex C
   Prp19-CDC5 complex
    110636146
Ribosome biogenesis [BR:hbr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110636146
Chaperones and folding catalysts [BR:hbr03110]
 Heat shock proteins
  HSP70 / DNAK
   110636146
Membrane trafficking [BR:hbr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110636146
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110636146
Proteasome [BR:hbr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110636146
Mitochondrial biogenesis [BR:hbr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110636146
Exosome [BR:hbr04147]
 Exosomal proteins
  Proteins found in most exosomes
   110636146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A PG_binding_4 Membralin
Motif
Other DBs
NCBI-GeneID: 110636146
NCBI-ProteinID: XP_021641393
Position
Unknown
AA seq 1203 aa AA seqDB search
MAGEGESPPIGIDLGTTYSCVGVWQHDHVEIIANDQGNRTTPSYVGFTDTKRLIGDAAKN
QVTMNPTNTVFDSKRLIGRRYSDASVQRDMKLWPFKVIVGPGDRPMIVVTHKGEEKQFTS
EEISSMVLMKMREIAEAYLGTTVKNAVVTVPAYFNDSQRQATMDAGVIAGLNVMCIVNEP
SAAAIAYGLDKKAGSFGERNVLIFDLGGGTFDVSLVNIQEGIFEVKSTAGDTHLGGEDFD
NRMVNHFVQEFKRRHNKDISGNPRALRRLRTACERAKRTLSSTGQTTIEIDFLYSGIDFY
TTITRGRFEELNRDLFKKCMEPVEKCLRDAKMDKSNVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQATILSGEGNEKVKDLLLLDVMPRSLGLETAGGIMSVLI
PRNTTIPIKKEQMFSTYSDNQLGVLIQVYEGERARTRDNNLLGKFELSGIPCAPRGVPLI
TVRFDIDANGILNVFAEDKTIGQKTKMTITNDKGRLSREEIEKMVQEAEKYKYEDEEHRK
KVEAKNALENYAYNMRFRDEKISAKPAIGIDLGTTYSHVGIWQHDHVEIIANDQGNRATP
SCVAFTNTERLIGDAAKNQVSKNPTNTVFDAKRLIGRRYSDASVQTDMKLWPFKVIAGLG
DRPMIIVTYKGEEKQFTSEEISSMVLMKMREIAETHLETTIKNAVVTVPAYFNDSQRQAT
MDAGVIAGLNVMCIINEPTAAAIVYGLDKKASSFGKKNVLIFDLGGGTFDVSLLTIEEVT
FEVKSIAGDAHLGGEDFDNRMVNHFVKEFKRRHKKDISGNPRALRRLRTACERAKRTLSS
TARTTIEIDFLYEHIDFYATITRARFEELNMDLFRKCMESVKKCLSDVKMDKTSVHDVVL
VGGSTRIPKVQQLLQDFFNGKELYKSINPDEAVAYGAAVQAAILSGEGNEKVEDLLLLDV
TPRSLVLETAGGVMTVLIPRNTTIPIKKRQVFSTDSDNQLGVLIQVYEGERNRTHENNLL
GKFELSGIPSAPRGVPRIDVCFDIDANGILNVFAKDKTTGQKNKITITNDKGRLSREEIE
KMVQEAEKYKYEDEEHKKKVKAKNALENYAYNMRFRDETISAKLSAANKKKIEDAIELAI
QWLGGNQLAEADEFKDKMKELESICNPIQGVPSTSRDMGRVIDEDGPSMGARSGIGPIIE
DVD
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgaaggagagagtccgccaataggaattgatctgggaacaacttactcttgt
gtgggagtttggcaacatgatcacgttgagatcatagctaacgaccaagggaatagaacg
acaccatcttatgtggggttcactgatactaaacgtttgattggagacgctgctaagaat
caggtcaccatgaatccaaccaacactgtttttgattctaaaaggttgattggaaggaga
tacagcgatgcctcggtgcaaagggacatgaaactatggccttttaaggtcattgttggc
cctggtgacagacccatgattgtagtgacacacaagggtgaagagaagcaattcacctct
gaggaaatctcttcaatggtcctcatgaaaatgcgcgagattgctgaggcgtaccttgga
accactgtaaagaacgctgttgttactgttcctgcttatttcaatgattcgcagcgtcaa
gccacaatggacgctggtgtcattgctggcctgaatgtgatgtgtattgtaaatgagccc
tctgctgctgctattgcttatgggcttgacaagaaagccggtagttttggtgagaggaat
gtgcttatctttgatctaggtggtggcacttttgatgtctctcttgttaacattcaagag
ggtatttttgaagtgaaatctacagctggagatacccatttaggaggggaagattttgac
aataggatggtgaaccactttgttcaagagtttaagaggaggcataacaaggatatcagt
ggtaacccaagagcattgaggaggttaaggaccgcttgtgagagggccaagaggactctt
tcatccactggtcaaactacaattgagattgatttcctttatagcggtattgatttttac
acaactattacccgaggtagatttgaagaacttaacagggatttatttaagaagtgtatg
gaacctgtggagaagtgcttgagggatgcaaagatggacaaaagcaatgtccatgatgtg
gttcttgttggtgggtctactaggattcctaaggttcaacaattgttgcaggatttcttc
aatggtaaagagctttgcaagagcattaaccctgatgaggctgtagcttatggtgctgca
gttcaagctacaatcctgagtggtgagggtaacgagaaggtcaaggaccttctattgctc
gatgtcatgcctcggtcccttggtttggagacagctggtggcattatgagtgtattgatt
ccaaggaacacgaccatccccatcaagaaagagcagatgttttccacctattctgataat
cagcttggagtgttgattcaggtctacgagggtgagcgagctagaacccgtgacaacaat
ttgctgggcaaatttgaattatctggcattccttgtgctcctaggggggttccactaatc
actgtccgctttgacattgatgccaatggtattctgaatgtctttgctgaggataaaaca
attggacagaagaccaagatgactatcactaatgacaagggcaggctttccagagaggag
attgagaaaatggtccaagaggcagagaaatacaagtatgaggatgaggaacacagaaag
aaggttgaggccaagaatgcactggagaactatgcttacaacatgagatttagagatgag
aagataagtgcaaagccagcaatcggaattgatctaggaacgacatactcccatgtggga
atttggcaacatgatcacgttgagatcatagctaatgaccagggtaatagagcaacacca
tcttgtgtcgcattcactaatactgaacgtttgataggagacgctgctaagaatcaagtc
tctaagaatccaacaaacactgtttttgatgctaagagattgattggaaggcgatacagc
gatgcatcggtgcaaacggacatgaaattatggccttttaaggtcattgctggccttggt
gacagacccatgattattgtgacatacaagggtgaagagaagcaattcacctctgaggaa
atctcttcaatggtcctcatgaaaatgcgagagattgctgagacgcaccttgaaaccact
ataaagaatgctgttgttactgttcctgcttatttcaatgactcgcagcgtcaagctaca
atggatgctggtgtcattgctggcctaaatgtaatgtgtattataaatgagcccactgca
gctgctattgtttatgggcttgacaagaaagccagtagttttggtaagaagaatgtgctt
atctttgatctaggtggtggcacttttgatgtttctcttcttaccattgaagaggttact
tttgaggtgaaatccatagctggagatgcccatttaggaggggaagattttgacaatagg
atggtgaaccacttcgttaaggagtttaagaggaggcataagaaggatattagtggtaac
ccaagagcattgaggaggttaaggactgcttgtgaaagggccaagaggactctctcatcc
actgctcgaactacaattgagattgatttcctttatgagcatattgatttttatgcaact
attactcgagctagatttgaagaacttaacatggatttatttaggaagtgtatggaatct
gtgaagaagtgcttgagtgatgtaaagatggacaaaaccagtgtccatgatgtggttctc
gttggtgggtctactaggattcctaaggttcaacaattgttgcaggatttcttcaatggt
aaagagctgtataagagcattaaccctgatgaggctgtagcctatggtgctgcagtccag
gctgcaatcctgagtggtgagggtaatgagaaggtcgaggaccttctattgctcgatgtc
actcctcggtcccttgttttggagacagctggtggcgttatgactgtattgattccaagg
aacacgaccatccccatcaagaaaaggcaagtgttttccactgattctgataatcagctt
ggagtgttgattcaggtctatgagggtgagcgaaatagaacccatgagaacaatttgcta
ggcaaatttgaattatctggcattccttctgctcctaggggtgttccacgaatcgatgtc
tgctttgacattgatgccaatggtattctgaatgtctttgccaaggataaaacaactgga
cagaagaacaagattactatcactaatgacaagggcaggctttccagagaggagattgag
aagatggtccaagaggcagagaagtacaagtatgaggatgaggagcacaaaaagaaggtc
aaggccaagaatgcactggagaactatgcctataacatgagatttagagatgagacgatc
agtgcaaaactctccgctgctaataagaagaaaattgaagatgcaattgagttggccatt
cagtggcttggtgggaatcaactcgctgaggcagatgaatttaaagacaagatgaaagag
ttggaaagcatctgcaacccaatccaaggggtaccaagcactagccgtgacatgggcaga
gtcatagatgaggatggtccttctatgggtgctagaagtggcattgggcccattattgag
gacgtggattaa

DBGET integrated database retrieval system