KEGG   Hevea brasiliensis (rubber tree): 110636257Help
Entry
110636257         CDS       T05150                                 

Definition
(RefSeq) flavonoid 3'-monooxygenase
  KO
K05280  flavonoid 3'-monooxygenase [EC:1.14.14.82]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00941  Flavonoid biosynthesis
hbr00944  Flavone and flavonol biosynthesis
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    110636257
   00944 Flavone and flavonol biosynthesis
    110636257
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hbr00199]
    110636257
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.82  flavonoid 3'-monooxygenase
     110636257
Cytochrome P450 [BR:hbr00199]
 Cytochrome P450, plant type
  CYP75 family
   110636257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 110636257
NCBI-ProteinID: XP_021641595
Position
Unknown
AA seq 525 aa AA seqDB search
MNFNIASTHFNMSTLIFYSIAFATFLYFLLHLRQLFLHRASRPLPPGPKPWPLLGNLPHL
GPKPHHSLADLARIYGPLMHLRMGFVDVVVAASASVAAQFLKVHDANFSNRPPNSGAKYV
AYNYQDLVFAPYGPRWRLLRKISSVHLFSGKALDDFRHIRQQEVAVLTRVLASAGQTQVN
LGQLLNVCTTNALGRVMIGRRVFNDGSSGGDPKADEFKSMVVELMVLAGVFNIGDFIPAL
EWLDLQGVAAKMKKLHKRFDDFLTEIVEEHKIKSDGYEKHRDMLSTLISLKEDADGEGEK
LTDTEIKALLLNMFTAGTDTSSSTVEWAIAELIRHPNILAQVQQELDSVVGRDRLVNELD
LAQLTYLQAVVKETFRLHPSTPLSLPRIAAEDCEINGYRISKGSTLLVNVWAIARDPDVW
AEPLKFRPERFLAGGEKANVDVRGNDFELIPFGAGRRICAGMNLGLRMVHLLIATLAHAF
EWELADGLIPEKLNMEEAYGLTLQRAVPMMVHPRPRLSSIAFNTA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaacatcgcttcaactcactttaacatgtctactctcatcttctactctata
gctttcgccaccttcctttactttctgctccaccttcgccaactcttcctccaccgtgcc
tcccgtcctcttccaccaggcccaaagccatggcctctccttggaaacttgcctcatttg
ggccctaaaccccaccactccttagctgacttggctcgaatctatgggcctctcatgcac
cttcgaatgggcttcgtggatgttgtggtggcggcttctgcctccgtcgcagcccaattc
ttgaaggttcatgacgcgaacttctcaaaccggccgccgaattccggtgcaaaatatgtt
gcttataattaccaagaccttgtgtttgcaccatatggtccgcggtggcgcctgcttagg
aagatcagctccgtccacctcttctccggcaaggcgttggatgattttagacacattaga
cagcaagaagtagcagtgcttacacgcgtactagcaagtgcgggccaaacgcaagttaac
ctaggacaattgctgaacgtgtgcaccaccaatgcccttgggcgcgtgatgataggcaga
agagtgtttaacgacggtagcagcggtggtgatccaaaggcagacgaattcaaatcaatg
gtggtggagttgatggtgttggccggagttttcaatatcggtgacttcattcctgctttg
gaatggctagacttacaaggagtagcagccaaaatgaagaagctccataagagatttgat
gatttcttgactgagattgtggaggagcacaagattaaatctgatggttacgaaaagcac
agagatatgttgagtacgttgatttctttgaaagaggatgctgacggtgagggagagaag
ctcaccgacactgaaatcaaagcattacttttgaacatgtttactgcaggtaccgatact
tcttcaagcacagtagaatgggcaatcgcagaactcatacgccaccctaatatcttggcc
caagtccaacaagagcttgactcggtcgtgggccgagaccgtctcgtaaatgaattagac
ctagcccaactcacctatctccaggccgtcgtcaaggaaaccttccgcctccacccatcg
acaccgttatctcttccacgcatcgcagcagaagactgtgaaataaatggctaccgcata
tccaagggctcaactcttctggtgaatgtatgggccatagcccgtgatccagatgtatgg
gccgagccgctaaagtttaggcccgaaaggtttttggcaggaggagagaaggcaaatgtt
gatgttaggggaaatgattttgagctaataccatttggtgctggacgcagaatatgtgca
ggaatgaacttggggttaaggatggttcacttgctaatagcaactctagcccatgcattt
gaatgggaattggcagatgggttgatccctgagaaattgaacatggaagaagcttatggg
ctaaccttgcagagggctgtgcccatgatggtgcacccaaggcctaggctatcctccatt
gcttttaatactgcatag

DBGET integrated database retrieval system