KEGG   Hevea brasiliensis (rubber tree): 110637046Help
Entry
110637046         CDS       T05150                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH11, chloroplastic-like isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110637046
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hbr03041]
    110637046
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110637046
Spliceosome [BR:hbr03041]
 Complex C
  Other components
   Step II factors
    110637046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C HA2 OB_NTP_bind IBR DEAD AAA_22 zf-C3HC4_2 AAA_19 ABC_tran RRM_1 AAA_29 AAA_30 Myosin_N
Motif
Other DBs
NCBI-GeneID: 110637046
NCBI-ProteinID: XP_021642659
Position
Unknown
AA seq 1716 aa AA seqDB search
MIPFSNHNQSSRHRQFRPPPQLNHNHPRQPRPQPRLFFVKLLSNHHRSGDRTLSVDSIVS
ECNPKPCKVQIRTSGTVAASLFFEHQADALDAVVSLWERRLAGDHLFTPVVGFNVDDDFN
ERLRSLFQLHVEKLLQGQSVGKLESKVNDLLVEIDKFACFFRKARDLRAFCEADGKKKRL
VEEKDLILNRIEEFKCAVKCVMDHLEGKEVEDLAVLGFKIGKGFNWHKIHSLLLRESKRL
EDGLPIYGYRREILQQIHLQQVMVLIGETGSGKSTQLVQFLADSGVASSGSILCTQPRKI
AAISLEKRVGEESIGCYEDNSIVCYPTYSSAQCFNSKVIYMTDHCLLQHLMKDRTLSGVS
CIIIDEAHERSLNTDLLLALIKELLIERGDLRLIIMSATVDASKLSEYFFGCRTFYVLGR
SFPIQIKYVPGDSGGSSGPLPSAIAPYVSDVVKMAIEIHQVEKEGAILAFLTSQLEVEWA
CEKFQSPSAIALALHGKLSHEEQCRVFQNYPGKRKVIFATNLAETSLTIPGVRYVVDSGM
VKESKFEPTSGMNVLRVSKISQSSANQRAGRAGRTEPGKCYRLYSESDYQSMDFHQEPEI
RKVHLGIAVLRILALGIKNVLEFDFIDAPSAKAVDMAIRNLLQLGAVGHRDDAFELTSDG
HYLVKLGIEPRLGKIILESCRCGLRKEGVALAAVMANASNIFCRVGTNDDKQKSDCHKVR
FCHRDGDLFTLLTVYREWESVSPDDRNKWCWNNSINAKTMRRCKETVQELENSLKNEFSI
IIPTYWLWSPYVVSAHDKNMKRIILSSLADNVAMYSGYDRLGYEVVLSGEYVQLHPSCSL
QVYGQKPNWVVFAELLSVSSQYLVCVTAVDFDCLSAFSPPLFDLSKMQSKKLQLRVIRGF
GSIILRRFCGKSNNSLLSLLSRIQTKLKDERIGIEMNVDSNEILLYASVQDMEKVNGLVV
DALEYEVKWLRNECLEKCLYHGGRAGASPPVALLGAGAEIKHLELESRNLSVDVFLSNTN
GADDKEVLAFIEKSVPGVCGFHRFAGSGQDSDDLEKWGRVTFLTPEAAGKALELNGFELS
GSLLKLSPARSSVGSGNKLSSFAAVKAKVTWPRRYSKGYAVIRCERNDAEHVVADCFNLL
IGGRIVHCELSQKDINCVIIRGLDRDTSELEILEVLQMHTTKRILDVFLIRGDAVNNPPL
GACEEAILKEIAPFMPNQGPLSNCCHVQVFYPEPKDTFMKAWITFDGSLHLEAAKALQHI
QGKVLAGCLSWQKMQCQRIFHSSVSCPAPVFAFIERQLNSLLKRLTRRPGVHCSLERNEN
GSYRVKISANATKTVAELRRPLEQLMKGKTVDHGCLTQAVLQLLFSRDGRLLMKSLQQEM
GTYILFDRQNLNVRIFGPENKVVLTEQKFVQSLLALHDNRQIDIPLRGGVMPHDLMKKVV
EKFGSDLHVLKEKFPEAAFMLNTRRHVISFSGKGDLRQRVEDVIHDFARSLSVSGTAEQP
GEAAATCPVCLCEVEDCYQLEACAHKFCRSCLVEQLESAMRGHDGFPVHCAHEGCGVRIW
LTDLKSLLPCERLEDLFRASLGAFVASSGGTYRFCPSPDCPSVYRVSGTEMVGGPFVCGA
CYAETCTRCHLEYHPCVSCERYKEFKEDPDLSLKDWCKGKENIKSCPVCGYIIEKVDGCN
HIECRCGKHICWVCSESFSSSDECYGHLRLVHLTII
NT seq 5151 nt NT seq  +upstreamnt  +downstreamnt
atgattcccttctccaaccacaatcagtcttcccgccaccgccaattccggcctcctccg
cagctcaaccacaatcacccgcgccaaccccgaccccaaccccgtttattttttgtcaaa
ctcctttccaaccaccatcgtagtggtgaccgtacgctttcagttgactctattgtctcc
gaatgcaatcccaaaccttgcaaagttcaaatcaggacctctggtacagttgctgccagc
ctcttttttgagcaccaggctgacgctctcgatgccgtcgtttccctctgggagcgccgg
cttgctggggaccatctgtttactccggtggttggttttaatgtcgacgatgattttaat
gagagacttagaagtttgttccaattgcatgtggagaagcttctacaagggcagtctgtg
gggaaattggagagtaaggtgaatgatttgcttgttgagattgataagtttgcgtgcttc
tttagaaaggctagggaccttcgagctttctgtgaggctgatggaaagaagaagcggttg
gtggaagagaaggatctaattttgaataggattgaggagtttaagtgcgcagtgaagtgt
gtgatggatcatctggaggggaaggaggttgaggatttggccgttttggggtttaaaatt
ggcaagggttttaattggcataaaatacatagtttgctattgagagagtctaagcgtctt
gaagatgggttgccgatatatggttatagaagggagattttgcagcaaatacatttgcag
caggtaatggtcttgattggagagacaggttcagggaagagtacgcagttggtacagttt
cttgctgattctggggttgcttccagtggttcaattttgtgtactcagcctcgcaaaatt
gctgcaatttcccttgaaaaaagggttggtgaagaaagcattggatgttatgaggataat
tcaattgtctgctatccaacttattcatctgcacagtgttttaattccaaggtaatatat
atgactgatcactgtctattgcagcaccttatgaaagataggactctgtctggagtttca
tgcattattatagacgaggcccatgaaagaagcttgaatactgatcttctgttggccttg
attaaagaattgcttattgagaggggtgacctaaggcttattataatgtctgcaacagtt
gatgccagcaaattatcagaatacttctttggttgtagaaccttttatgtgttggggaga
agctttcctattcaaatcaaatatgttcctggtgactctggaggctcttctggccccttg
cccagtgctattgctccatatgtttctgatgttgttaaaatggctatcgagatccatcaa
gtggagaaagagggggcaattcttgcgtttttgacttctcagctggaggtagaatgggct
tgtgaaaagtttcagtctccctcagcaattgcattggcactacatggaaagctttcccat
gaagagcaatgtcgtgttttccagaattatcctgggaagagaaaagttatttttgctacc
aatttggcagagacatccttgactattcctggggtcaggtatgtggttgattctggaatg
gttaaggaaagcaagtttgaacctacatctggtatgaatgtcctcagggtttccaagatt
agccagagttctgctaatcaacgagctggtcgtgctggtcgaacggaacctggaaaatgt
taccggctttactcggaatctgattaccagtcaatggatttccatcaagaacctgaaatt
cgtaaagttcaccttggtattgcagttttgaggattcttgcattgggtattaagaatgtg
ctggaatttgattttattgatgctcctagtgcaaaggcagttgacatggccatcaggaac
cttctgcagttaggtgctgttggccacagagatgatgcttttgaattgacttcagatggg
cattacttggttaagttgggtattgaacctcgacttgggaagattattcttgaaagctgc
cgttgtggtctgcgtaaagaaggtgttgctcttgctgctgttatggcaaatgcaagtaac
atattttgcagagttggtaccaatgatgacaaacaaaaatcagattgccataaggtgcga
ttctgccaccgtgatggtgatctcttcacattgcttactgtctacagggaatgggaaagt
gtatctccagatgatagaaataagtggtgttggaacaatagcatcaatgccaaaactatg
cgaagatgcaaagagacagtgcaagagttagagaacagtttaaaaaatgaatttagcatc
attataccaacttactggctttggagtccttatgttgtctcagcgcatgataaaaatatg
aagagaattatactttcttcactagcagataatgtagccatgtactctggatatgatcgc
cttggttatgaggtggttttgagtggggaatatgttcaacttcatccttcatgttcgctg
caagtgtatggccaaaagccaaactgggttgtctttgctgaactcttatctgtatcaagt
caatatttggtctgtgttactgcagttgactttgattgtttgtctgcatttagtcctcct
ttatttgacctttcgaagatgcagagtaaaaaattgcagttgagggtgatcagaggattt
ggcagtattattttaagaaggttctgtggaaagtcaaataatagcttgctctctcttctg
tctcgcatacagacaaaattgaaggatgagcggataggtattgaaatgaatgtggatagt
aatgagattctattatatgcatctgtacaagacatggaaaaggtgaatggccttgttgtt
gatgcattagaatatgaagtaaaatggttaagaaatgagtgcctggagaagtgcttgtat
catgggggacgagctggtgcttctccaccagtagcgcttcttggagctggtgcggaaatt
aagcatctggagttggaaagtagaaatttgagtgtggacgtgttcctttcaaatacaaat
ggtgcagacgacaaggaggtcttggcattcattgaaaaatcagtgcctggggtgtgtggt
tttcacagatttgcaggaagtggacaggatagtgacgatttggagaagtggggcagggta
acatttcttactcctgaagcagctgggaaagcactagagttaaatggatttgagttatct
ggttctttacttaagttgtcacctgctagatcatctgttggaagtggtaataaattatca
tcatttgcagctgtaaaagccaaagtcacttggccacgaaggtacagtaaaggttatgct
gttattagatgtgaaaggaatgatgctgagcatgttgttgcagattgctttaatctgctg
attggaggcaggatagttcattgtgagctgagccaaaaggatataaactgtgttattatc
agaggattggatagagatacttctgaattggaaatacttgaagttctgcaaatgcacaca
actaagagaattttggatgtattcctgatacgaggtgatgccgtaaataatcctcctctt
ggtgcttgtgaggaagcaattctcaaggaaattgctccattcatgcctaaccagggtcct
ttgagcaattgctgtcatgttcaggtattctaccctgagccaaaggatacttttatgaag
gcgtggataacctttgatgggagtctacatctggaggctgcaaaagccttgcaacatatt
caagggaaggtacttgctggttgtttatcatggcagaaaatgcagtgccagcggattttc
catagttctgtgtcatgccctgctcctgtttttgcattcattgagaggcagctaaactct
ttgctcaaaaggttaacgcgtcgacctggtgttcattgcagtttagaaaggaatgaaaat
ggttcctatagagtgaagatatctgctaatgctacgaagacggtagcagagttgaggagg
ccactggagcagctaatgaagggaaagacagtcgatcatggttgcctcactcaagcagtt
ctgcagcttcttttttccagagatggcagattgcttatgaagtcactgcaacaagaaatg
ggaacttacattctctttgataggcagaacctcaatgttaggatctttggtccagagaac
aaagttgttcttaccgaacagaagtttgtacaatcccttttggcactccatgataacagg
caaatagatatccctcttcgaggtggagttatgccacatgatcttatgaaaaaagttgtt
gagaagtttggatctgacttgcatgtgctaaaagagaagttccctgaggctgcatttatg
cttaacacgaggcgccatgtcatttctttcagtggtaaaggggatctgaggcaaagagtg
gaggatgtaattcatgattttgcacgatctcttagtgtcagcggaactgctgaacaacct
ggagaagcagctgctacctgccctgtttgcttgtgtgaagttgaggactgttaccagctt
gaggcttgtgcacataagttctgccggtcttgcttggttgaacaattagagtcagcaatg
agaggacatgatggtttccctgtacactgtgcccatgaaggttgtggggtgcgcatttgg
ctaacggatttgaagtcccttctgccatgtgaaaggttggaggatcttttcagagcctct
ttgggggcatttgttgcatctagtgggggcacttacaggttttgcccctctcctgactgt
ccttctgtttaccgggtatcaggcactgagatggttggaggtccatttgtgtgtggagca
tgctatgcagagacatgtacgaggtgtcacttggagtatcatccatgtgtgtcatgtgaa
agatacaaagagttcaaggaggatcctgatttgtccttgaaggactggtgcaagggaaaa
gagaatattaagagctgtccagtttgcgggtatataattgagaaggtggatggctgcaac
cacattgagtgtagatgtggcaaacacatctgctgggtctgctcagaatcttttagcagt
agtgatgagtgctatgggcacttgaggcttgtacatctcactataatatga

DBGET integrated database retrieval system