KEGG   Hevea brasiliensis (rubber tree): 110639644Help
Entry
110639644         CDS       T05150                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK15
Organism
hbr  Hevea brasiliensis (rubber tree)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Adeno_E3_CR2 Pkinase_fungal TMEM154 EphA2_TM Syndecan ABC1 TraL
Motif
Other DBs
NCBI-GeneID: 110639644
NCBI-ProteinID: XP_021646372
Position
Unknown
AA seq 592 aa AA seqDB search
MSSPAPETSPPVPTSPSTVPTSPPATNSTSPPPPPSQTNSTASSPPPETNSTVSTPPVTN
STSFQPPPSSDSTNGSTTSFSPPSFSPPSKGLPPGALAGLIVGIALGAIIVLIAMGIFFI
CYRRKKRKEALSSKDDHNRRPPQHWQQNHPPPTDNKVTSLPNPAPPPGISLKPCQSPVLC
PASHEPPSTSSSLGFEKTSPGILGLSQGTFSYEELAIATNSFSDANLVGQGGFGYVHKGV
LSDGKVVAIKQLKAGSRQGEREFQAEIEIISRVHHRHLVSLVGYCITGVQRMLVYEYIPN
NTLEFHLHGKERPAMNWSTRMKIAVGSAKGLAYLHEDCQPKIIHRDIKSANILLDDIFEA
KVADFGLAKHSLDTDTHVSTRVMGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRR
PVDRTQSFLDDSIVDWARPLLKQALEEGTYDALVDPKLQGEYDSSEMSRMISCAAACIRH
SARLRPQMSQIVRALEGNMPLDDLSDGITPGHSMIYGSYGRSDYSSSQYKEDLKKFRKMA
LESQEHGSSEYSGVTSEYGVQPSSSSTEGQQTTKEMESQRKETTTKDSHEIL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgccagccccggaaacctctccccctgttcccacttcgccttccactgttccc
acctcgcctccagctacgaactccacgtcacctccgccgccaccatcgcagactaactcg
actgcttcgtctccgccaccggagaccaactccactgtttcaacgcctccggtgactaac
tcaacctcttttcagcctccaccatcgtcggattctacgaatggctcgacgacgtctttt
tcaccgccgtctttttcaccgccgtctaaggggctacctcctggtgctctggcggggcta
attgtgggaatagctttgggagcaataattgtactgattgctatgggcattttcttcatt
tgttaccggagaaagaagagaaaggaggcactgagttctaaagatgaccataacagacgc
ccgccgcagcattggcaacagaatcaccctccacctacagacaataaagtgacgtcgctg
cctaaccctgcccctcccccaggaatctctttaaagccctgtcagtcaccagtgctttgt
cctgcttcccatgaacctccttcgacaagtagcagtttgggctttgagaagacatctcct
ggaattcttggactttcacagggtaccttttcttatgaagaacttgcaatagcaactaat
agtttctccgatgcaaaccttgttggtcagggtggttttggttatgtccacaagggagtc
cttagtgatggtaaagtggttgcaattaagcagcttaaagcagggagtagacagggggaa
cgtgaatttcaggcagaaattgagatcattagtcgtgtccatcacagacatcttgtttca
ttggttggatactgcattactggagtccagaggatgcttgtatatgaatatattccaaac
aacaccttggaattccatctacatggaaaggagagaccagctatgaactggtcaactaga
atgaaaattgctgtaggctcagcaaaaggattggcttacttgcatgaagattgtcagccc
aagatcatacaccgtgatatcaagtcagccaatattcttcttgatgatatctttgaagca
aaggttgctgattttggacttgccaagcattctttggatactgatactcatgtctccacc
cgagtgatgggaacttttggttatatggctccagagtatgcctcttctggtaagcttacc
gagaaatcagatgtcttttcctttggcgttgtgcttcttgagttgattacggggcgccga
cctgttgataggactcaatccttccttgatgatagcatagttgattgggcaaggcctttg
ctcaaacaagctttggaagaaggcacctatgatgctcttgttgatccaaagttacagggg
gaatatgattccagtgaaatgagtcgaatgatttcatgtgctgcagcttgtatacgtcat
tcagcacggcttcggccacaaatgagccagatagttcgagctttggaaggaaatatgccc
ctagatgatttaagtgatggaatcacacctgggcacagcatgatatatggttcttatgga
aggtcagactatagttctagccaatacaaggaagacttgaagaaattcaggaagatggcg
ctagaaagccaagaacatggtagtagtgagtacagtggagtcaccagtgagtatggtgta
cagccttccagcagtagcactgagggccaacaaactacaaaagagatggaatcacagaga
aaggagacaaccaccaaagattcccatgaaattttgtga

DBGET integrated database retrieval system