KEGG   Hevea brasiliensis (rubber tree): 110640366Help
Entry
110640366         CDS       T05150                                 

Definition
(RefSeq) alcohol dehydrogenase-like 1
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00010  Glycolysis / Gluconeogenesis
hbr00071  Fatty acid degradation
hbr00350  Tyrosine metabolism
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
hbr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110640366
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110640366
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110640366
Enzymes [BR:hbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     110640366
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     110640366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 110640366
NCBI-ProteinID: XP_021647347
Position
Unknown
AA seq 379 aa AA seqDB search
MAMSRSSNTSQVITCKAAVIWGVGEELKVEEIQVDPPNSSEVRVKMLCASICHTDVSRAH
GFPFPLFPVVLGHEGVGVVESIGDKVNGLKEGDVVIPTFLAQCQECENCTSQETNLCLKF
PLNLKGLMPDDTSRMSIRGHKLYHLFTCSTWSEYMVIDSNYVAKIDPTIPLPYASILSCG
FSTGFGAAWKEAKVKEGSSVAVLGLGAVGLGATEGARMQGAATIIGVDKNSKRREKGQAF
GMTHFINPDEFDKPISQLVKDLTGGLGVDYCFECSGAAPLVNEALQSTKMGIGKAIAIGS
GNAAVTIDFLPLLTGRTLKGSLFGGLTINSDLPYVLDKCKNKEFHLDELLTHEVSLQDID
KAFEMFKQPDCVKVLIKIH
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggccatgtcaaggagcagcaacacctcacaggtcataacatgcaaagctgcagtaata
tggggagttggggaggaattgaaggtggaagagatacaagtggacccaccaaattcttct
gaagttagagtcaagatgctttgtgctagtatttgtcacactgacgtctctcgtgcccat
ggatttccatttccacttttccctgtagttctaggacatgaaggcgttggagtggtggag
agcataggagacaaagtaaatgggctaaaagaaggagatgttgtgatcccaaccttcctt
gcacagtgccaagaatgcgaaaattgcacatcacaagagactaatctgtgcctaaaattc
ccactaaacctcaagggtctaatgccagatgacacctcaagaatgtccattagaggccat
aagttgtaccacttgtttacttgctccacctggtctgaatacatggttattgattccaac
tacgttgcaaagattgatccaaccatacctctgccttatgcaagtattttatcatgtggg
ttttcaactgggtttggagcagcttggaaggaagcaaaggttaaagaaggttcaagtgtg
gctgtattaggccttggtgcagttgggttaggggccactgaaggagctcgaatgcaaggg
gcagctaccataataggtgtagataagaatagtaaaagaagagaaaagggacaagctttt
ggaatgacacatttcataaacccagatgaatttgacaaacccatttcacaactggtgaaa
gacctgactggtggattaggagtggattattgcttcgagtgcagtggcgctgcaccctta
gtcaatgaagctcttcaatccacaaaaatgggaataggaaaagcaatagcgataggttct
ggaaatgcagctgtgacaattgacttcttgcccttactgacaggcagaactcttaagggc
tccctttttggagggctcacaataaattctgaccttccatatgtgctcgacaaatgcaaa
aacaaggaattccatcttgatgagcttttgactcatgaagtttcattgcaagatatagac
aaagcgtttgagatgttcaagcaaccagattgtgtaaaggttcttatcaagattcactag

DBGET integrated database retrieval system