KEGG   Hevea brasiliensis (rubber tree): 110641752Help
Entry
110641752         CDS       T05150                                 

Definition
(RefSeq) probable receptor-like protein kinase At1g80640
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
hbr  Hevea brasiliensis (rubber tree)
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hbr01001]
    110641752
Enzymes [BR:hbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110641752
Protein kinases [BR:hbr01001]
 Serine/threonine kinases: TKL group
  IRAK family
   110641752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Usp
Motif
Other DBs
NCBI-GeneID: 110641752
NCBI-ProteinID: XP_021649275
Position
Unknown
AA seq 526 aa AA seqDB search
MVQASVPASPRESVIVVMDANRSKGSMDALDWALKSVVRRQDTVIVLGVSCAFGKKNSCF
PLNMGISISAIWERLEFSSQGQGEARPKELGEEIERKKEQYQNNLQPFYRLCRKNEVNME
VKLAFGFCPEKITVEQAQNSNPRWIVLDSNLKKHKVIIYAHVGCNIAVMNGKDVATLTPS
RAPPPGNCTPTDDTTYTTNQTADNQDGFAPSQDGESSARPQSPCWYPLSWRNGFPRAFTQ
TELEEITNDFSEDNLIRVEDNIKVYEGIFQETPVVIMSFPESDERFWTMLKILSRVRHRN
IANLVGFCCTGTSLFLLFDYPCLGTLELNLLNDNLARNLPWKARWYIAVEIGGSLRYLHE
ECVDGGAIVHLSVCSPHVLFSNGCSSMLTVCLPLPFKLSNFTTARWLDQDNAPSNEDTVA
ENANLEEDDVRGYGMLLIELISGKSARLHRNESGGQSLIQWALPLLENGQISEVLDPRLE
DNADIRVAYHMVKAALLCLRSDADHRISMSEVLAVVRGDQLAMAKC
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaagcttctgttccggcttctccaagggagagtgtgatagttgtgatggatgct
aacaggagtaaaggaagcatggatgcactagactgggctctcaaaagtgtcgttcgccgg
caagatactgtgattgttcttggagtttcatgtgcttttggaaagaagaattcttgtttt
cctttgaacatgggcattagcatctctgcaatatgggaaagattggagttctcaagccag
gggcaaggagaagctagaccgaaagagcttggggaagaaattgagagaaaaaaggaacaa
tatcagaataaccttcaaccattctacagactatgtagaaagaatgaggtgaacatggaa
gttaaacttgcttttggattttgtccagagaaaataacagttgagcaagctcaaaactcc
aatcctcgttggattgtattagacagcaacttaaagaaacacaaggtaatcatatatgca
catgttggatgcaacattgctgtaatgaatgggaaagatgtagcgactttgacaccatca
agagctcccccgcctggaaattgcacaccaacggatgatactacttacaccacaaaccaa
actgcggacaatcaggatggttttgctccttctcaagacggagagtcgtcagcacgacct
caaagtccttgttggtatccgctgtcatggagaaatggatttcctcgagcatttactcaa
acggagcttgaagagatcacaaatgatttctcagaagataatcttattcgagttgaggat
aacataaaggtttatgaggggatatttcaggaaactcctgttgtaatcatgtctttccca
gaaagtgatgagcgcttctggacaatgctgaagatcctttcccgagtacgccatcggaat
atagcaaaccttgtcggattctgctgcacaggaacttcacttttcttgctttttgactac
ccctgcttaggaactcttgaactaaatttgctgaatgacaacttagctaggaacctgcct
tggaaagcaaggtggtatattgcagtggaaataggtggtagcttgcgctatctgcatgaa
gagtgtgttgatggaggagccattgttcacctctctgtttgttcccctcatgttcttttc
tctaatggttgctctagtatgctaactgtttgccttccattgccattcaagctctccaac
ttcacaactgctaggtggctcgatcaagataatgctccaagcaacgaagatactgtagct
gagaatgcaaatctagaagaagatgatgtacgtggttatgggatgttactgattgagctc
ataagcggcaagagtgctcgtttgcatcgaaatgagagcggaggacaaagcttgattcaa
tgggcactgccacttcttgaaaatggtcagataagtgaagtgttagatcctagactggag
gataacgctgacattagggtggcttatcatatggtcaaggctgctttactttgcttgaga
agtgatgcagatcacaggatttctatgagtgaggtcttagctgtggttcgaggtgatcag
cttgccatggctaaatgctaa

DBGET integrated database retrieval system