KEGG   Hevea brasiliensis (rubber tree): 110641827Help
Entry
110641827         CDS       T05150                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00052  Galactose metabolism
hbr00500  Starch and sucrose metabolism
hbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110641827
   00500 Starch and sucrose metabolism
    110641827
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110641827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 110641827
NCBI-ProteinID: XP_021649368
Position
Unknown
AA seq 661 aa AA seqDB search
MADPNPFLPISQPLHPTYTSLPDGTHPSGSPATHSLPSKKLLLGIFFGFLLVFLFVALIG
DHNGSQQNILSQEDENVASLASPKETAKPETLRPISRGVSAGVSEKASLISSGSESSTDQ
YPWNNSMLSWQRTAFHFQPEKNWMNDPNGPLYYKGWYHFFYQYNPHAAVWGDIVWGHAVS
RDLIRWLHLPLAMVADQWYDQNGVWTGSATILPDGKIVMLYTGSTNESVQVQNLAYPADP
SDPLLLDWIKYSGNPVLVPPHGIDTKDFRDPTTAWYTSEGKWRISIGSKVGKTGIALIYD
TEDFINYKLQPQALHGVPGTGMWECVDFYPVSRNGEHGLDTSANGPEVKHVVKASLDDDR
HDYYALGTYSELNSTWTPDNPDIDVGIGLRYDYGIFYASKTFYDQNKGRRVLWGWIGESD
SEVADVKKGWASLQGIPRTVSLDTKTGSNLLQWPVEEVESLRLRSNEFDKVEVKPGSVVP
LNLDAATQLDIIAEFELDKKVLENAAESNEEFSCKTSNGAAHRNALGPFGLLVLADDSLA
EQTPVYFYVTKGRNGTLKTFFCTDQSRSSAANDVNKQIYGNFVPVLKGEKFTLRILVDHS
IIESFAQGGRTTITSRVYPTRAIYGRAKLFLFNNAIKANVTASLKIWQMNSAFIRPYPNT
R
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccctaacccattccttcctatatctcaaccacttcatcctacctacacttct
ctcccagatggcactcacccatctggatctccggccacccacagcctcccctctaagaaa
ctgctcctcgggatctttttcgggtttttgctggttttcttgtttgtagctttaattggt
gatcacaatggatcacagcagaacattctttcacaagaagatgaaaatgtagcgtcattg
gcttcgccgaaagagacggcgaaaccggagactttgaggcctatctcccgtggcgtctcg
gctggtgtctctgagaaagccagcctgatttctagtggatcggaatcttcgacggatcag
tatccatggaacaatagcatgttatcatggcaaagaactgctttccacttccaacctgag
aaaaactggatgaatgatcctaatggtccattgtattacaagggctggtaccatttcttc
taccagtacaatccacatgctgcggtatggggtgacatagtgtggggccatgctgtatca
agggacttaatccgctggcttcacctcccattagcaatggttgctgatcaatggtacgac
cagaatggcgtgtggactggctccgccactatcctcccagatggtaaaatcgtcatgcta
tacactggatccaccaatgaatccgttcaggtacagaatcttgcttatccagcagacccc
agtgatcctcttctccttgactggatcaaatactctggcaatccggttttagtcccacca
cacggcattgacaccaaggacttccgcgacccaaccacagcttggtacacttccgagggg
aaatggcgcatcagcatagggtctaaagttggcaaaactggtattgctttgatttatgac
actgaggatttcataaattataagttgcaacctcaagcacttcatggtgtacctggcact
ggcatgtgggagtgtgtggacttttaccctgtttcaaggaacggtgaacatggattggat
acatctgctaacggccctgaagtgaagcatgtagttaaggcaagccttgatgatgatagg
catgattactatgcactggggacttactccgaattaaacagtacatggactccagataat
ccagatattgatgttggcattggtcttaggtatgattatggtatattctacgcatccaag
acattttatgatcagaataaagggagaagggtattatggggttggattggcgagtctgat
agtgaagttgctgatgttaagaaaggatgggcatctcttcagggcattccaaggacagtc
tcgttggacacaaagactggcagcaatctgcttcaatggccagtggaagaggtagagagt
ttgagactaagaagcaatgaatttgacaaggtggaagtcaagccagggtcagttgtgccc
cttaatcttgatgcagccacacagctagatattatcgcggagtttgagttagacaagaag
gtattggagaacgcggctgaatctaacgaggagttcagctgcaagaccagtaacggagct
gctcaccgcaatgcgttaggaccattcggccttctggttcttgctgatgacagccttgcc
gaacagacccctgtatacttctacgttacaaaaggaagaaatggcaccctcaaaactttc
ttctgcacagaccaatcaaggtcttctgcagcaaatgatgttaacaaacaaatttatggt
aacttcgttccagtcctgaaaggtgaaaaattcactctaaggatattggtggatcattca
ataattgaaagctttgcccaagggggaagaacgacaatcacctccagggtttatccaaca
agggcaatctatggaagggccaagctctttttgttcaacaatgccattaaagccaatgtg
actgcttcactcaagatatggcaaatgaattctgcattcattcgtccctatccaaatacc
cggtag

DBGET integrated database retrieval system