KEGG   Hevea brasiliensis (rubber tree): 110642279Help
Entry
110642279         CDS       T05150                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00052  Galactose metabolism
hbr00500  Starch and sucrose metabolism
hbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110642279
   00500 Starch and sucrose metabolism
    110642279
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110642279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Corona_NS4
Motif
Other DBs
NCBI-GeneID: 110642279
NCBI-ProteinID: XP_021649958
Position
Unknown
AA seq 578 aa AA seqDB search
MAIFFMRLFFYFFVLHFGHGVFELEASHHVYHTFQNLEESAVSATSQPYRTGYHFQPPKN
WMNDPNGPMIYKGIYHLFYQYNPKGPVKGKGSIVWAHSTSRDLVNWTPQKVAIYPSQPSD
IDGTWSGSATILQDGTPALLYTGINPLHQQVQNLALPKNSSDPYLLEWVKSPKNAVMAPA
PENQINASSFRDPTTAWLGVDGRWRVIIGSKINRKGLAYLYRSKDFVHWIKAKRPLHSAK
NTGMWECVDFFPVSVNSPVGFDTSTLGPTVKHVLKASLDDTKHDYYTIGEYDHAKDIYIP
DEGSLDGDSGLRYDYGKFYASKTFFDSAKNRRLLWAWLNESSSVSDDIKKGWAGIQAIPR
AVWLDKSGKQLVQWPIEEIEMLRTNPVHLPSQDLKGGSVLEVPSVTAAQADVEITFKLSN
FRKAEVLDPSWTNPQLLCSQKGTSVRGSLGPFGLLVLASKGMQEYTSVFFRIFKGQNKHV
VLMCSDQSRSSLNPDNDKTTYGTFVDVDPVHKQLSLRSLIDRSVVESFGGQGKSCISARV
YPTLAINKAAHLYAFNNGSESVTITRLSAWSMKKAHIN
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcttttttatgaggctcttcttctacttctttgttctccactttggccatggg
gtttttgagcttgaagcttcccatcatgtttaccatacgtttcaaaatcttgaagaatct
gcagtttctgcaacaagtcaaccttacagaaccggttatcactttcaacctcccaagaac
tggatgaatgatccaaatgggccaatgatttacaagggaatttaccacctgttctaccaa
tacaatcctaaaggacctgtaaagggcaagggcagcatcgtatgggcccactcaacttca
agagatcttgttaattggaccccacaaaaggttgccatctatccatctcaaccatcagat
attgatggcacctggtctggttcagccacaatcctccaagatggtacacctgctcttctt
tacacgggaattaacccactacaccaacaagttcaaaacttggccttgcccaaaaactca
tctgatccatacctcttagaatgggtgaaatcacccaaaaatgctgttatggcacccgcc
cctgagaaccaaattaatgctagctcattcagagacccaaccactgcctggcttggtgtt
gatggaagatggagggtgatcattggaagcaaaattaaccgcaagggattagcatatctt
tacagaagtaaagattttgttcattggattaaagccaaacgcccattgcattctgccaag
aacactggaatgtgggaatgtgtggatttttttccagtgtcagttaatagcccagttggg
tttgatacatcaacattgggaccaactgttaagcatgtgcttaaggcgagtttagatgat
actaaacatgattactacacaataggagaatatgatcatgcgaaagatatttatattccg
gatgaaggatcactggatggtgattctggcttaagatatgattatgggaaattttatgcc
tcaaaaactttcttcgacagtgctaagaacagaaggctcttgtgggcttggctaaatgaa
tcttctagtgttagtgatgatatcaagaagggttgggctggaattcaggcaattccaaga
gctgtctggcttgacaaatcaggaaagcaactggtgcaatggcctatcgaagaaattgaa
atgcttcgtacgaatccagtccacttgcctagccaagaccttaagggaggatctgtgctt
gaagtccctagtgtcacagcagcacaggcagatgtggagattacatttaagttatcaaat
tttagaaaagcggaagtgctagacccaagctggactaacccgcaattgctttgtagccaa
aagggtacctcagttagaggcagtttaggtccatttgggttgctggttttggcttctaaa
ggcatgcaagagtatacatctgttttctttagaatattcaaaggccagaacaaacatgtg
gtgcttatgtgcagtgaccaaagcaggtcttcactaaatccagataatgataagaccact
tatgggacatttgtggacgtggaccccgttcataagcaattgtcattaagaagcttgatt
gatcgttcagtagtggaaagctttggtggacaaggaaagagctgcatttcagcaagagtc
tatcccaccttggcaataaataaggcagcccacttgtatgctttcaataatggaagtgaa
agtgttactatcacaagactgagtgcttggagtatgaagaaggctcatatcaactga

DBGET integrated database retrieval system