KEGG   Hevea brasiliensis (rubber tree): 110642818Help
Entry
110642818         CDS       T05150                                 

Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA12-like
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    110642818
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hbr03021]
    110642818
Transcription machinery [BR:hbr03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     110642818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C HypA DZR C1_1 RNHCP DUF3716 zf-H2C2_2
Motif
Other DBs
NCBI-GeneID: 110642818
NCBI-ProteinID: XP_021650674
Position
Unknown
AA seq 117 aa AA seqDB search
MAHSRGHRFMFCDLCGTMLSLKTLQYAECPLCKFKKSAKEVIGKEIHYKVTAEDMRRDLG
ISHFEGKMEVKDMEINKKCEKCSNTKLKFSTRQMRSADEGQTTFYHCPSCLHTFSEN
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcacattctcgcggacatcgttttatgttctgtgacctatgtgggacgatgctatct
ttgaaaacacttcaatatgctgagtgtcctttgtgcaaatttaagaaaagtgcaaaagag
gtaattggaaaagaaatacattataaagtcactgctgaggatatgagaagggatctgggt
atctcacattttgaaggaaagatggaggtgaaagacatggagataaataagaaatgtgaa
aaatgcagcaacacaaagcttaaattttccaccagacaaatgagatcagcagatgagggg
cagactactttctatcactgtcctagttgtttacatacttttagcgagaattga

DBGET integrated database retrieval system