KEGG   Hevea brasiliensis (rubber tree): 110643242Help
Entry
110643242         CDS       T05150                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00260  Glycine, serine and threonine metabolism
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
hbr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    110643242
Enzymes [BR:hbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     110643242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 110643242
NCBI-ProteinID: XP_021651238
Position
Unknown
AA seq 368 aa AA seqDB search
MVAEKQHSKMVTRTVDLRSDTVTKPTEAMRAAMANAEVDDDVLGYDPTASRLETEMAKIM
GKEAALFVPSGTMGNLVSVLVHCDVRGSEVILGHNSHIHIYENGGISTLGGVHPRTVPNN
KDGTMDINLIEAAIRDPRGGLVYPTTRLICLENSQANCGGRCLSVEYTDRVGELAKKHGL
KLHIDGARIFNAAVALGVPVHRLVQAADSVSVCLSKGLGAPVGSVIVGSKSFIAKARILR
KTLGGGMRQVGILCAAALVALQENVGKLEDDHKKAKTLAEGLNQIKGLRVDKILLFVAPC
IYLDILDDSKFTAENLSKSLEQHGVLVMLEGPFSIRIVLHHQISASDVQYTLSCFQQALT
GVQDENGN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttgcagaaaaacaacactcaaagatggtaaccagaacagtggatctccggtctgac
actgtcactaaaccaactgaagcaatgagggcagctatggcaaatgctgaggttgatgat
gacgttctgggttatgacccaactgcgtcacggttagagactgaaatggccaaaatcatg
ggcaaggaagcagctctttttgttccatcaggcaccatgggtaaccttgttagtgtgctt
gtgcattgtgacgttaggggaagtgaagtaattcttggacacaattctcacatccacata
tatgagaatggaggcatttcaactcttggaggtgtgcatccaaggacagtgccgaataac
aaggatggaacgatggatatcaatttaattgaagctgcaattagagatccaagaggggga
cttgtgtatccaactactaggcttatctgcctggagaattcacaagccaactgtggtggt
agatgcctatctgtagaatatacagatagagttggagaattagctaaaaagcatggtttg
aagcttcacattgatggggctcgcattttcaatgcagcagttgcgcttggagttcctgtg
cataggcttgttcaagctgctgattcagtttcggtatgcctatcaaaaggtttgggtgcg
ccagttggatcagttattgttggttcaaaaagctttattgcaaaggctagaatccttagg
aaaacattaggaggtgggatgcgacaggttggtatcctttgtgccgctgctttagttgcc
ttgcaagagaacgttggaaagcttgaggatgatcacaagaaagccaagacactagcagag
ggactgaatcaaattaaaggactaagagtggataaaattttactttttgttgctccttgc
atatatttggacatactagatgactcaaaatttacagcagaaaatctaagcaagagcttg
gaacaacatggtgtacttgtgatgttagagggcccattcagcattaggattgttcttcac
caccaaatttcagcaagtgatgtgcagtacactttatcatgctttcagcaagctttaaca
ggggtgcaagatgaaaatggcaactag

DBGET integrated database retrieval system