KEGG   Hevea brasiliensis (rubber tree): 110644251Help
Entry
110644251         CDS       T05150                                 

Definition
(RefSeq) beta-glucosidase 12-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
hbr00460  Cyanoamino acid metabolism
hbr00500  Starch and sucrose metabolism
hbr00940  Phenylpropanoid biosynthesis
hbr01100  Metabolic pathways
hbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    110644251
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    110644251
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    110644251
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     110644251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 110644251
NCBI-ProteinID: XP_021652638
Position
Unknown
AA seq 524 aa AA seqDB search
MFDVEKQLTMTIKGLLCLVFSFLVAFSVAHSEQGTNKSTSSLKRSSFPADFVFGTASSSY
QYEGAAFEDGKGPSIWDTFTQRHPEKVEDHSSGKIADDSYHRYKEDVAIMEGLGFDAYRF
SISWPRILPLGYVRGGTNQKGIDYYNNLINELLSNGIKPFVTLFHWDVPQALEDEYASFL
SPKIIKDFRDYAELCFNKFGDRVKHWITLNEPLIYASGGYASGLIAPGRCSNSSSSNCTE
GDSSTEPYIAGHYQLLAHAAAVKVYREKFQKSQEGQIGITLNSGWFEPLTESSNDRIAAS
RAMAFQYDWFMEPLKSGLYPVDMLKFVGKRLPKFSKKEALMVKGSFDFIGINYYSANYAS
DIPCTTQNVSYFTDPCVNISTHRNGIPIGKKGGSFWLYIYPRGILDLLLYTKHKFDDPVI
YITENGVSEVNTGSVSLKDKLRVNYHRDHLSFLQNAMEIGVNVKGYFAWSLLDNFEWSSG
YTVRFGLVFVDYKDGLKRYPKKSANWFRKFLGSGNHTKSNDMEL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgttgaaaagcaattaaccatgacaatcaaaggccttctttgcttggttttc
agtttcttggttgccttctcagtggctcacagtgaacaaggtacgaataagagtacctct
tctcttaaacgaagcagttttccagcagattttgtgtttggaactgcatcatcttcttac
cagtacgaaggtgcagcatttgaagatggtaagggacctagtatatgggataccttcact
cagaggcatccagagaaggtcgaggaccacagcagtggaaagattgctgatgactcgtat
cataggtacaaggaagatgtagctatcatggaaggcttaggttttgatgcttacagattt
tccatctcctggcctagaattttgcctcttggttacgttagaggaggaacaaatcagaag
ggcatcgattactacaacaatctcatcaatgaactcctgtcaaatggaatcaaacctttt
gtgactctattccactgggatgttccacaagcccttgaagatgaatatgctagtttttta
agccccaaaattataaaagattttcgagactatgcagagttatgcttcaacaaatttggt
gatagggtaaagcactggattacattgaacgagccactaatctatgctagtggtgggtat
gcatctggtttaattgcacctggtagatgttcaaattcttcctcttcaaactgcactgaa
ggtgattccagcactgagccatacatagcaggccactaccagcttcttgctcatgctgct
gcagttaaagtctacagggaaaagttccagaaatctcaagaaggccaaattgggattaca
ctaaattcaggctggtttgaaccgttaactgagtccagtaatgatcgtattgcagcatct
agagccatggctttccagtatgattggtttatggagccactaaagtctggtttataccca
gttgatatgcttaaatttgtgggaaaacgattgccaaaattttctaaaaaggaagccttg
atggttaaagggtcattcgatttcattgggataaactactattctgcaaattatgcaagt
gatattccttgcacaacccaaaacgtgagctacttcactgacccttgtgtcaatatctca
acacacagaaatgggatcccaattggtaaaaagggaggatcattttggctttatatttat
ccaagagggattttagatcttctgctgtataccaagcacaagtttgatgatcctgtcatc
tatatcactgagaatggagtaagtgaggtaaatactggttctgtttctctgaaggataag
cttagagtaaactaccaccgtgatcatctttctttccttcaaaatgcaatggagattggc
gtgaatgtgaagggatactttgcgtggtcattgcttgacaatttcgaatggagttctggt
tatactgttcgttttggtctggtttttgtagactacaaggatggattgaaaagatatcca
aaaaaatcagccaactggttcagaaaatttcttggctctgggaatcacactaaatcaaac
gatatggaactttga

DBGET integrated database retrieval system